Innovationen für die Wirtschaft

Ergebnisse industrieller Gemeinschaftsforschung
839 abgeschlossene Vorhaben mit 1181 beteiligten Instituten.
FA 1 - Schweißmetallurgie und Werkstoffverhalten
Vorhaben: DVS-Nr.: 01.004 / IGF-Nr.: 98.060 N
Werkstoff- und Prozeßuntersuchungen beim Plasma-Pulver-Auftragschweißen mit gesteigerter Auftragleistung
Laufzeit vom 01.04.1994 bis 31.03.1996
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 01.006 / IGF-Nr.: 98.220 N
Untersuchungen zur Herstellung von Oberflächenschutzschichten aus metallkeramischen Verbundwerkstoffpulvern (Cermet-Pulver) mit thermischen Plasmen
Laufzeit vom 01.07.1996 bis 30.06.1999
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.009 / IGF-Nr.: 10.331 N
Festigkeits- und Korrosionsuntersuchungen an Magnesium-Legierungen in Abhängigkeit vom Schweißverfahren
Laufzeit vom 01.01.1996 bis 31.12.1998
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
Vorhaben: DVS-Nr.: 01.011 / IGF-Nr.: 10.625 B
Untersuchungen zum qualitätssicheren Lichtbogenschweißen von hochsilizium-haltigen hochlegierten Werkstoffen
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
Vorhaben: DVS-Nr.: 01.012 / IGF-Nr.: 10.626 B
Entwicklung korrosionsbeständiger Auftragschweißschichten mit hoher Verschleißfestigkeit auf Eisenbasis
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.013 / IGF-Nr.: 11.377 N
Untersuchung der Randbedingungen für die Bildung von „acicular ferrite“ in Schweißgütern bei schneller Abkühlung
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.014 / IGF-Nr.: 11.376 N
Untersuchung zur Minimierung der Rißanfälligkeit beim UP-Schweißen von hochfesten Feinkornbaustählen der Qualität StE 890 und StE 960
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.016 / IGF-Nr.: 11.660 N
Untersuchungen zum Schweißen von hochlegierten Cr-Ni-Stählen mit selbstschützenden Fülldrahtelektroden unter Wasser
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.017 / IGF-Nr.: 11.381 N
Schweißbedingte Anlauffarben – müssen grundsätzlich blanke Nähte gefordert werden? Abschätzung des korrosiven Einflusses von gelben Anlauffarben auf geschweißte CrNi(Mo)-Stähle
Laufzeit vom 01.10.1995 bis 30.09.1997
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Hannover
Vorhaben: DVS-Nr.: 01.020 / IGF-Nr.: 11.808 N
Untersuchungen zum Einfluß der metallurgischen und geometrischen Schwächung beim Schweißen von Stahlwerkstoffen für den Leichtbau
Laufzeit vom 01.11.1998 bis 31.10.2000
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.023 / IGF-Nr.: 11.879 B
RES-Hochgeschwindigkeits-Plattieren von warmfesten Feinkornbaustählen
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Mecklenburg-Vorpommern GmbH
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.024 / IGF-Nr.: 11.934 N
Metallurgische Untersuchungen zum Beschichten dünner Substrate mit Blechdicken > 2mm
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.025 / IGF-Nr.: 11.931 N
Werkstoffkundliche Bewertung von mit dem MIG/MAG-Tandemschweißen hergestellten Auftragschichten
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 01.027 / IGF-Nr.: 12.622 N
Untersuchungen zur Entwicklung von ausscheidungshärtbaren Schichten aus Nickelbasis-Superlegierungen
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.029 / IGF-Nr.: 12.934 B
Erarbeiten werkstoffkundlicher Kennwerte geschweisster Aluminiumbauteile in Abhängigkeit von der Wärmeeinbringung
Laufzeit vom 01.07.2001 bis 30.06.2003
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Mecklenburg-Vorpommern GmbH
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.030 / IGF-Nr.: 12.489 N
Beanspruchungsgerechter Verschleißschutz im Aluminium-Formenbau durch Entwicklung und schweißtechnische Verarbeitung neuer Legierungen
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.032 / IGF-Nr.: 12.772 N
Metallurgische und korrosionsschemische Untersuchungen zur Herstellung von Plasma-Pulver-Nachplattierungen aus Ni-Basislegierungen
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.033 / IGF-Nr.: 12.754 B
Entwicklung vanadinkarbidhaltiger Schweißzusatzwerkstoffe auf Nickelbasis zum Schutz gegen Verschleiß und Korrosion
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.034 / IGF-Nr.: 12.674 N
Untersuchungen zum Schweißen in kaltgeformten Bereichen von Feinkornbaustählen mit Streckgrenzen von mindestens 355 Nmm-2
Laufzeit vom 01.11.2000 bis 30.06.2003
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.037 / IGF-Nr.: 13.137 N
Verbesserung der mechanischen Eigenschaften von Schweißverbindungen an Titanwerkstoffen
Laufzeit vom 01.03.2002 bis 31.05.2004
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
2) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.038 / IGF-Nr.: 13.136 B
Metallurische Untersuchungen zur Entwicklung von Cu- und Ni-Basiswerkstoffen für den Plasma-Pulver-Lötprozess
Laufzeit vom 01.02.2002 bis 31.01.2004
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.039 / IGF-Nr.: 13.139 B
Untersuchungen zur schweißtechnischen Verarbeitung von Silizium-basierten Hartstoffen zur Erhöhung der Verschleißbeständigkeit
Laufzeit vom 01.03.2002 bis 29.02.2004
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) CeWOTec gGmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.041 / IGF-Nr.: 13.096 N
Neue verschleißfeste und korrosionsbeständige Auftragschweißlegierungen auf Chrom-Mischkristallbasis zur Standzeiterhöhung hochbelasteter Baugruppen der Förder- und Extrusionstechnik
Laufzeit vom 01.11.2001 bis 31.10.2003
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.042 / IGF-Nr.: 14.429 N
Untersuchung zur Entstehung von Lötrissen von verzinkten Stahlfeinblechen beim Löten
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.043 / IGF-Nr.: 13.482 N
Entwicklung eines Fertigungskonzeptes zur Herstellung von längsnahtgeschweißten Spezialrohren mit Tieftemperaturanforderungen zum Transport saurer Medien
Laufzeit vom 01.02.2003 bis 31.01.2005
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) RWTH Aachen Institut für Eisenhüttenkunde Lehrstuhl Werkstofftechnik der Metalle

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.044 / IGF-Nr.: 13.718 N
Bandplattieren von hochverschleißbeständigen Auftragsschweiß-schichten auf Eisenbasis mittels Elektroschlackebandplattieren
Laufzeit vom 01.05.2003 bis 30.04.2005
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.046 / IGF-Nr.: 13.961 B
Charakterisierung und Qualifizierung hochkarbidhaltiger Verschleiss-schutzschichten hinsichtlich des Einsatzes unter stark korrosiven Bedingungen
Laufzeit vom 01.08.2004 bis 31.07.2006
Beteiligte Institute:
1) CeWOTec gGmbH
2) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.048 / IGF-Nr.: 13.770 B
Untersuchung der metallurgischen Grundlagen zum Plasma-Pulver-Verbindungsschweißen dünner Aluminiumbleche
Laufzeit vom 01.06.2003 bis 31.05.2005
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.049 / IGF-Nr.: 13.864 N
Verbesserung der Heißriss-Sicherheit beim UP-Schweißen von Nickelbasislegierungen unter dem Aspekt gesteigerter Wirtschaftlichkeit
Laufzeit vom 01.02.2005 bis 31.01.2007
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.052 / IGF-Nr.: 14.432 N
Vermeidung von Heißrissen beim Schweißen austenitischer Stähle und Nickelbasislegierungen mit gepulsten Lasern durch Verwendung von Schweißzusatzwerkstoffen in Form von Beschichtungen
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.057 / IGF-Nr.: 14.839 N
MSG-Löten mit Fülldrähten zur Steigerung der Festigkeitseigenschaften am Beispiel höherfester Stahlwerkstoffe
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.058 / IGF-Nr.: 15.201 B
Metallkundlich-technologische Untersuchungen zur Schweißeignung neuartiger austenitischer Fe-Mn-Stähle
Laufzeit vom 01.04.2007 bis 30.06.2009
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.059 / IGF-Nr.: 15.203 B
Erarbeiten der metallurgischen Grundlagen für das Beschichten mit hochwolframhaltigen Pseudolegierungen
Laufzeit vom 01.08.2007 bis 31.07.2009
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.060 / IGF-Nr.: 15.637 N
Metallurgische Grundlagen zum Fügen mittels im Puls modulierbarer Laserstrahlquellen
Laufzeit vom 01.07.2008 bis 31.12.2010
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.061 / IGF-Nr.: 15.564 N
Untersuchung zur Vermeidung der Wasserstoffversprödung beim Lichtbogenbolzenschweißen an Stahlwerkstoffen
Laufzeit vom 01.03.2008 bis 28.02.2010
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.062 / IGF-Nr.: 15.816 B
Entwicklung von Verschleißschutzschichten auf Basis von Nickelhartlegierungen auf Aluminiumbauteilen mittels Plasma-Pulver-Auftragschweißen
Laufzeit vom 01.10.2008 bis 31.12.2010
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.063 / IGF-Nr.: 15.596 N
Entwicklung von Fügetechnologien für Leichtbauanwendungen mit schmiedbaren Gamma-Titanaluminiden verbesserter Duktilität
Laufzeit vom 01.06.2008 bis 28.02.2011
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.064 / IGF-Nr.: 15.915 N
Werkstoffgerechtes Fügen von hochfesten Pipelinestählen der Qualitäten X100 und X120 unter Baustellenbedingungen
Laufzeit vom 01.12.2008 bis 30.11.2010
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.065 / IGF-Nr.: 16.034 B
Legierungssysteme für Fülldrähte zum MSG-Schweißen von Aluminium-Knet- und Druckgusslegierungen
Laufzeit vom 01.04.2009 bis 31.12.2011
Beteiligte Institute:
1) Brandenburgische Technische Universität Cottbus-Senftenburg Lehrstuhl Füge- und Schweißtec
2) CeWOTec gGmbH
3) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.066 / IGF-Nr.: 16.277 B
Metallkundlich-technologische Untersuchungen zum Elektronenstrahlschweißen mit kombinierter Mehrprozesstechnik von austenitisch-ferritischen Stählen ohne Schweißzusatz
Laufzeit vom 01.12.2009 bis 31.05.2012
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.067 / IGF-Nr.: 16.242 N
Verbesserung der Schweißeignung von Aluminium durch Kornfeinung
Laufzeit vom 01.10.2009 bis 30.09.2011
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv
2) BIAS - Bremer Institut für angewandte Strahltechnik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.069 / IGF-Nr.: 16.316 B
Schweißmetallurgische Untersuchungen zum wärmereduzierten MAG-Verbindungsschweißen heißrissempflicher Ni-Basislegierungen
Laufzeit vom 01.03.2010 bis 29.02.2012
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.071 / IGF-Nr.: 16.364 B
Schweißen von pulvermetallurgisch hergestellten ferritischen Chromstählen
Laufzeit vom 01.02.2010 bis 31.01.2012
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.072 / IGF-Nr.: 16.492 N
Generieren und Fügen von SLM-Bauteilen aus Hartmetall
Laufzeit vom 01.05.2010 bis 31.12.2012
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) BIAS - Bremer Institut für angewandte Strahltechnik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.073 / IGF-Nr.: 16.748 B
Untersuchungen zur Vermeidung von Heißrissen beim Laserstrahlschweißen von austenitischen Cr-Ni-Stählen und Nickelbasislegierungen mittels Temperaturfeld-Tailoring
Laufzeit vom 01.10.2010 bis 31.03.2013
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.077 / IGF-Nr.: 29.000 B
Untersuchungen zur Steigerung der Verschleißfestigkeit von Magnesiumlegierungen
Laufzeit vom 01.04.2000 bis 31.03.2002
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.079 / IGF-Nr.: 17.430 B
Ressourceneffizientes und werkstoffgerechtes Fügen von hochbeanspruchten Stählen
Laufzeit vom 01.09.2012 bis 31.08.2014
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht
2) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
3) BIAS - Bremer Institut für angewandte Strahltechnik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.081 / IGF-Nr.: 17.403 B
Verbesserung der Schweißeignung von Ni-Basis-Schleuder- und Sandformguss
Laufzeit vom 01.02.2012 bis 31.07.2014
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.082 / IGF-Nr.: 17.538 B
Entwicklung hoch schlag- und abrasionsbeständiger Legierungen für auftraggeschweißte Verschleißschutzschichten
Laufzeit vom 01.12.2012 bis 30.11.2014
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
2) CeWOTec gGmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.083 / IGF-Nr.: 17.843 N
Standzeitverlängerung von Druckgusswerkzeugen aus Warmarbeitsstählen durch regeneratives Elektronenstrahlschweißen mit lokaler prozessintegrierter Wärmebehandlung
Laufzeit vom 01.12.2013 bis 31.03.2016
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.084 / IGF-Nr.: 17.524 N
Untersuchung des Einflusses der materialabhängigen Eigenschaften von Aluminiumdrahtelektroden auf die Stabilität und das Schweißergebnis bei Schutzgasschweiß-prozessen
Laufzeit vom 01.12.2013 bis 31.05.2016
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.088 / IGF-Nr.: 18.596 B
Ermittlung geeigneter Wärmeführungen zur Vermeidung wasserstoffunterstützter Kaltrisse beim Schweißen höherfester Feinkornbaustähle mit modifiziertem Sprühlichtbogen
Laufzeit vom 01.01.2015 bis 30.06.2017
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.4-Integrität v. Schweißverbind
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.089 / IGF-Nr.: 18.390 B
Erhöhung der Beständigkeit gegenüber Porenbildung beim MSG- und UP-Schweißen von Super-Duplexstahl (SDSS)
Laufzeit vom 01.10.2014 bis 31.03.2017
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.091 / IGF-Nr.: 18.172 B
Entwicklung hochverschleißfester Hartauftragungen mit guter Zerspanbarkeit
Laufzeit vom 01.05.2015 bis 30.04.2017
Beteiligte Institute:
1) CeWOTec gGmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 01.222 / IGF-Nr.: 82.390 N
Verbesserung der Heißrißsicherheit und Zähigkeit beim Unterpulverschweißen unlegierter und niedriglegierter Stähle durch Beeinflussung der Sulfidausscheidungsform im Schweißgut
Laufzeit vom 01.07.1996 bis 31.08.1998
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 01.223 / IGF-Nr.: 82.450 N
Verhalten von nichtmetallischen Einschlüssen in der Wärmeeinflußzone und im Aufmischungsbereich von mikrolegierten Feinkornbaustählen
Laufzeit vom 01.06.1990 bis 31.05.1992
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.224 / IGF-Nr.: 86.330 N
Elektroschlacke-Auftragschweißen von NiMo28
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 01.225 / IGF-Nr.: 83.680 N
Elektroschlacke- und Plasmapulver-Auftragschweißen von Duplex-Stähle mit 25 % Cr und 7 % Ni
Laufzeit vom 01.08.1995 bis 31.07.1997
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 01.228 / IGF-Nr.: 86.200 N
Diffusibler Wasserstoff im Unterpulver-Schweißgut - Einflüsse der Schweißanlage
Laufzeit vom 01.08.1991 bis 31.07.1993
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 01.229 / IGF-Nr.: 86.210 N
Ermittlung von Kriterien zur Einteilung von UP-Schweißpulvern nach ihrem metallurgischen Verhalten
Laufzeit vom 01.08.1991 bis 31.07.1993
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 01.230 / IGF-Nr.: 86.130 N
Einfluß von Niob, Vanadin und Bor auf die Eigenschaften der Grobkornzone in titanlegierten Feinkornbaustählen
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.231 / IGF-Nr.: 86.120 N
Untersuchungen zur Erzeugung hochabriebfester Schutzschichten mit homogener Hartstoffeinbettung durch Plasma-Pulver-Auftragschweißen mit zusätzlicher Heißdrahtzufuhr
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.233 / IGF-Nr.: 24.000 Q
Einfluß des Schmelzschweißprozesses auf die Güte von Schweißverbindungen aus Gußblech
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.234 / IGF-Nr.: 11.000 D
Entwicklung des Fertigungsschweißens von un- und niedriglegiertem warmfesten Stahlrohguß in Verbindung mit einer nachfolgenden Normalisierung
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.235 / IGF-Nr.: 70.000 D
Vergleichende Untersuchungen zum Senkrechtschweißen unter Einsatz des MAG-Verfahrens mit Massivdrähten, Fülldrähten und metallpulvergefüllten Drähten, des Fallnahtelektroden und Hochleistungs-Elektroden
Laufzeit vom 01.12.1990 bis 28.02.1993
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 01.236 / IGF-Nr.: 40.000 D
Verbesserung der Wirtschaftlichkeit beim Schweißen hochlegierter Werkstoffe
Laufzeit vom 01.12.1990 bis 31.03.1993
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
2) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv
Vorhaben: DVS-Nr.: 01.237 / IGF-Nr.: 13.900 D
Untersuchungen zum Einfluß der Gefügeparameter auf das Bruchzähigkeitsverhalten der Wärmeeinflußzone geschweißter GGG-Verbindungen durch Schweißsimulationsversuche
Laufzeit vom 01.05.1991 bis 31.08.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.238 / IGF-Nr.: 13.800 D
Wärmeführung beim Auftragschweißen von Verschleißteilen aus un- und niedriglegiertem Stahlguß unter Einsatz neuer Steuerungstechniken
Laufzeit vom 01.05.1991 bis 31.08.1993
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Mecklenburg-Vorpommern GmbH
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.239 / IGF-Nr.: 23.500 D
Untersuchungen zur Gütesicherung von Schutzgasverbindungsschweißungen durch online Temperaturfelderfassung und -verarbeitung
Laufzeit vom 01.06.1991 bis 31.10.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.240 / IGF-Nr.: 29.300 D
Vergleich zwischen integraler und diskreter Betrachtungsweise der Kaltrißproblematik von Schweißverbindungen höherfester Stähle unter Berücksichtigung des Umwandlungsverhaltens
Laufzeit vom 01.11.1991 bis 31.10.1993
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Mecklenburg-Vorpommern GmbH
2) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg
Vorhaben: DVS-Nr.: 01.241 / IGF-Nr.: 33.200 D
Software zur Wärmeführung beim Schweißen von Feinkornstählen zur Vermeidung wasserstoffbeeinflußter verzögerter Kaltrißbildung
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Mecklenburg-Vorpommern GmbH
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.242 / IGF-Nr.: 29.100 D
Prozeßintegrierte Wärmebehandlung unter Sensorführung als Qualitätssicherungsmaßnahme beim Guß-Stahl-Verbindungsschweißen
Laufzeit vom 01.06.1991 bis 30.11.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.244 / IGF-Nr.: 97.450 N
Prüfung der Mikrorißanfälligkeit in der Wärmeeinflußzone beim Schweißen von vollaustenitischen CrNi-Stählen, CuNi- und Ni-Basislegierungen
Laufzeit vom 01.04.1994 bis 30.09.1996
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv
Vorhaben: DVS-Nr.: 01.245 / IGF-Nr.: 93.210 N
Wasserstoffaufnahme im Tropfenstadium beim Metall-Schutzgas-Schweißen von niedriglegierten Feinkornbaustählen
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.246 / IGF-Nr.: 93.120 N
Bedeutung der Austenitkorngröße für das Umwandlungsverhalten und die Zähigkeit im Grobkornbereich der Wärmeeinflußzone bei Stählen mit unterschiedlichen Grundwerkstoffgefügen“
Laufzeit vom 01.01.1993 bis 30.06.1995
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.247 / IGF-Nr.: 94.320 B
Untersuchungen zum Auftragschweißen von vanadinkarbidhaltigen Hartstoffschichten gegen abrasiven Verschleiß
Laufzeit vom 01.07.1993 bis 30.06.1995
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.250 / IGF-Nr.: 92.390 B
Einfluß der Anlaufschichten auf das Korrosionsverhalten von Nickelbasislegierungen
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 01.251 / IGF-Nr.: 93.200 N
Untersuchung des Wasserstoffefusionsverhaltens von Proben aus Schweißgut in Abhängigkeit von der Temperatur und der chemischen Zusammensetzung- Prof. Dahl -
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.252 / IGF-Nr.: 93.190 N
Grundlegende Untersuchungen zur Metallurgie beim Auftragschweißen mit dem Plasma-Impuls-Lichtbogen
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 01.253 / IGF-Nr.: 93.180 N
Erweiterung des t 8/5-Konzeptes naxh SEW 088 auf das Schweißen un- und niedriglegierter Stähle mit unterschiedlichen Wanddicke.
Laufzeit vom 01.06.1993 bis 31.05.1995
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 01.254 / IGF-Nr.: 95.940 N
Ermittlung der Auswirkung von Einflußgrößen auf die Mindesvorwämtemperatur für kaltrißsicheres Schweißen an bauteilähnlichen Proben
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 01.255 / IGF-Nr.: 10.233 N
Ermittlung von Korrelationen zwischen Sauerstoffaktivität und Schweißnahteigenschaften beim UP-Schweißen un- und niedriglegierter Stähle
Laufzeit vom 01.08.1995 bis 31.07.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 01.256 / IGF-Nr.: 96.290 N
Untersuchung der Verteilung von schädlichen und unschädlichen Wasserstoffanteilen in hochfesten Schweißgütern mehrlagiger Schweißnähte und Ermittlung der günstigsten Wärmebehandlung zur Vermeidung von Kaltrissen
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 01.257 / IGF-Nr.: 95.820 N
Modifizierung von umhüllten Stabelektroden zum Schweißen von Super-Duplexstählen und -gußlegierungen zur Verbesserung der mechanisch - technologischen Eigenschaften
Laufzeit vom 01.10.1993 bis 30.09.1996
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.260 / IGF-Nr.: 94.330 B
Fertigungs- und Eigenschaftsoptimierung für das Schweißen und Wärmebehandeln von niedriglegierten, warmfesten Stahlguß
Laufzeit vom 01.07.1993 bis 30.06.1995
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 01.999 / IGF-Nr.: 09.320 N
Untersuchung des Wasserstoffefusionsverhaltens von Proben aus Schweißgut in Abhängigkeit von der Temperatur und der chemischen Zusammensetzung - Prof. Dahl -
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
FA 2 - Thermische Beschichtungsverfahren und Autogentechnik
Vorhaben: DVS-Nr.: / IGF-Nr.:
Herstellung von besonders oxidarmen metallischen Schichten durch Kaltgasspritzen
Laufzeit vom 01.11.2000 bis 31.10.2002
Beteiligte Institute:
1) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 02.000 / IGF-Nr.: 14.966 B
Korrosion thermisch gespritzter oxidkeramischer Schichten
Laufzeit vom 01.09.2006 bis 31.08.2008
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Keramische Technologien und Systeme I

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.001 / IGF-Nr.: 15.501 N
Entwicklung und Herstellung nachbearbeitungsarmer Schichtsysteme zum kostenkünstigen Korrosions- und Verschleißschutz mit Fe-Basis-Feinstpulvern
Laufzeit vom 01.02.2008 bis 31.01.2011
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.002 / IGF-Nr.: 15.502 N
Entwurf, Aufbau und Anwendung mobiler Diagnostiken für den Hartchromersatz-Beschichtungsprozess
Laufzeit vom 01.02.2008 bis 31.01.2011
Beteiligte Institute:
1) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.003 / IGF-Nr.: 15.503 N
Kaltgasgespritzte Schichten zum Lasergravieren für Tiefdruckwalzen
Laufzeit vom 01.02.2008 bis 31.01.2011
Beteiligte Institute:
1) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.004 / IGF-Nr.: 15.504 B
Zerstörungsfreie Charakerisierung thermisch gespritzter Schichten mittels thermografischer Prüfmethoden
Laufzeit vom 01.02.2008 bis 31.01.2011
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.005 / IGF-Nr.: 15.505 N
Feinstrukturierte Werkstoffe auf Fe-Basis und korrespondierende Verarbeitungsverfahren für den Verschleiß- und Korrosionsschutz
Laufzeit vom 01.02.2008 bis 31.01.2011
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.006 / IGF-Nr.: 10.381 N
Untersuchungen zur Herstellung von Duplex-Schutzschichten durch Hochleistungspalsma-Pulver-Auftragschweißen (HPPA)
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 02.008 / IGF-Nr.: 10.369 N
Zentrale Pulverzufuhr beim Plasma-Pulver-Auftragschweißen
Laufzeit vom 01.05.1991 bis 31.08.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 02.010 / IGF-Nr.: 10.706 N
Untersuchungen zum Einfluß der Karbidart und -form auf die Eigenschaften hartstoffverstärkter Schutzschichen
Laufzeit vom 01.06.1996 bis 31.05.1998
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 02.011 / IGF-Nr.: 10.623 B
Verbesserung der Beständigkeit von TS-Schichten durch umweltverträgliche Nachbehandlungsmedien
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
Vorhaben: DVS-Nr.: 02.012 / IGF-Nr.: 10.655 N
Hochgeschwindigkeits-Flammspritzen von WC-haltigen Hartmetallschichten - Verbesserung der Schichteigenschaften durch Kontrolle der Phasenumwandlungen im Spritzprozeß
Laufzeit vom 01.04.1996 bis 31.03.1998
Beteiligte Institute:
1) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg
Vorhaben: DVS-Nr.: 02.013 / IGF-Nr.: 10.628 N
Thermisch gespritzte Beschichtungen mit Hochleistungspoymeren
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.014 / IGF-Nr.: 11.001 N
Lebensmittelverträglichkeit thermisch gespritzter Schichten
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 02.015 / IGF-Nr.: 11.010 N
Untersuchungen zum Hochgeschwindigkeitsbrennschneiden für das Zuschneiden von Formteilen und zur Schweißnahtvorbereitung
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
Vorhaben: DVS-Nr.: 02.016 / IGF-Nr.: 11.004 N
Verbesserung der Eigenschaften thermisch gespritzter Oferflächenschutzschichten durch den gezielten Einsatz von Substratkühlung
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.017 / IGF-Nr.: 10.977 N
Verbesserung des Verschleißverhaltens von Aluminiumlegierungen durch Plasma-Pulver-Schweißverfahren
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.018 / IGF-Nr.: 11.658 B
Qualitätsbeurteilung thermisch gespritzter Schichten mit Hilfe thermographischer Methoden
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
Vorhaben: DVS-Nr.: 02.019 / IGF-Nr.: 11.466 N
Herstellung von Aluminiumoxidschichten mit verbesserten Eigenschaften
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg
Vorhaben: DVS-Nr.: 02.020 / IGF-Nr.: 11.663 B
Nutzung von stickstoffhaltigen Hochtemperaturplasmen zum reaktiven Beschichten mittels Plasma-Auftragschweißen
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 02.021 / IGF-Nr.: 11.532 B
Entwicklung von Pufferschichtsystemen und Methoden zu deren Herstellung für erhöhte mechanische und thermische Beanspruchung von beschichteten Aluminium und Aluminiumgussbauteilen
Laufzeit vom 01.04.1998 bis 31.03.2000
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
Vorhaben: DVS-Nr.: 02.022 / IGF-Nr.: 11.880 B
Herstellung SiC-haltiger Verbundschichten für hochbeanspruchte Bauteile und Werkzeuge mittels des HVOF-Verfahrens
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
Vorhaben: DVS-Nr.: 02.023 / IGF-Nr.: 11.813 B
Entwicklung eines Beratungssystems für den Oberflächenschutz durch thermisches Spritzen
Laufzeit vom 01.11.1998 bis 31.10.2000
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Mecklenburg-Vorpommern GmbH
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
3) Leibniz Universität Hannover Institut für Werkstoffkunde
Vorhaben: DVS-Nr.: 02.024 / IGF-Nr.: 11.935 N
Thermisch gespritzte Schichten quasikristalliner Werkstoffe für den Einsatz in Lagern und anderen durch Reibung beanspruchten Bauteilen
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.025 / IGF-Nr.: 12.490 N
Beschichtung von Aluminiumschäumen zum Verschleiß- und Korrosionsschutz
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.026 / IGF-Nr.: 12.488 N
Substratvorbereitung durch Trockeneisstrahlen und Beschichten durch thermisches Spritzen in einem Arbeitsschritt - Prof. Bach -
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 02.027 / IGF-Nr.: 12.577 B
Untersuchungen zur Festigkeitsoptimierung hochverschleißbeständiger Schutzschichten
Laufzeit vom 01.08.2000 bis 31.07.2002
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.028 / IGF-Nr.: 12.641 B
Plasmaspritztechnische Herstellung von hochwertigen Permanentmagnetschichten für die Mikrosystemtechnik
Laufzeit vom 01.12.2000 bis 31.03.2003
Beteiligte Institute:
1) Technische Universität Ilmenau FG Plasma u. Oberflächentechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.029 / IGF-Nr.: 12.671 N
Herstellung von besonders oxidarmen metallischen Schichten durch Kaltgasspritzen
Laufzeit vom 01.11.2000 bis 31.03.2003
Beteiligte Institute:
1) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.030 / IGF-Nr.: 12.756 N
Thermisches Spritzen von Metallen mit submikro- nanokristallinen Dispersionen
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.031 / IGF-Nr.: 12.771 B
Entwicklung auf Wärmedurchgang optimierter Schichtsysteme für tribologisch hoch beanspruchte Bauteile
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.032 / IGF-Nr.: 13.481 N
Entwickeln und Qualifizieren von Methoden zum selektiven Entfernen thermisch gespritzter Schichten
Laufzeit vom 01.03.2003 bis 28.02.2005
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.033 / IGF-Nr.: 13.985 B
Untersuchungen zum Hochgeschwindigkeitsdrahtflammspritzen - WIEDERVORLAGE -(alt: 04252/01 B)
Laufzeit vom 01.09.2004 bis 31.08.2006
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.034 / IGF-Nr.: 13.413 N
Erschliessung neuer Einsatzmöglichkeiten für Spritzschichten durch Mikroplasmaspritzen
Laufzeit vom 01.09.2002 bis 31.08.2004
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.036 / IGF-Nr.: 13.769 N
Beschichtung von Leichtbaulegierungen auf Magnesiumbasis zum Verschleiß- und Korrosionsschutz
Laufzeit vom 01.06.2003 bis 31.05.2005
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.038 / IGF-Nr.: 13.786 N
Einfluss des Verhältnisses von Substrattrauheit und Spritzpartikel auf die Haftung thermisch gespritzter Schichten
Laufzeit vom 01.02.2005 bis 31.01.2007
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.039 / IGF-Nr.: 14.350 N
Untersuchung der Störgrößeneinflüsse beim Atmosphärischen Plasmaspritzen mit modernen on-line Prozessdiagnostiken
Laufzeit vom 01.02.2005 bis 31.01.2007
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.040 / IGF-Nr.: 13.774 N
Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik
Laufzeit vom 01.10.2004 bis 31.12.2006
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.042 / IGF-Nr.: 14.509 N
Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinstfraktionierten Pulvern
Laufzeit vom 01.02.2006 bis 31.01.2008
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.043 / IGF-Nr.: 15.232 B
Untersuchung des Einflusses der Morphologie der Wolframcarbide auf die Eigenschaften von Verschleißschichten am Beispiel des Plasmapulverauftragschweißens
Laufzeit vom 01.06.2007 bis 31.05.2009
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.045 / IGF-Nr.: 14.926 B
Entwicklung multifunktioneller keramischer Schichten im System TiO2-Cr2O3
Laufzeit vom 01.08.2006 bis 31.07.2008
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Keramische Technologien und Systeme I

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.050 / IGF-Nr.: 14.880 N
Thermisch gespritzte Diffusionssperrschichten für CFC-Bauteile in Hochtemperaturanwendungen
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.051 / IGF-Nr.: 14.510 N
Herstellung und Charakterisierung HVOF-gespritzter Cermet-Beschichtungen mit Titankarbidverstärkung
Laufzeit vom 01.04.2006 bis 31.03.2008
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.053 / IGF-Nr.: 14.930 N
Reproduzierbare und vergleichbare Ermittlung von Haftfestigkeitswerten für thermische Spritzschichten - Untersuchung und Bewertung der Fehlergrößen im Haftzugversuch nach DIN EN 582
Laufzeit vom 01.01.2007 bis 31.03.2009
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.055 / IGF-Nr.: 15.563 B
Einsatz wasserverdüster Metallpulver zum thermischen Beschichten
Laufzeit vom 01.09.2008 bis 31.08.2010
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
2) CeWOTec gGmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.056 / IGF-Nr.: 16.029 B
Entwicklung einer schnellen zerstörungsfreien Prüfmethode zur Messung mechanischer Kennwerte und der Porosität an thermisch gespritzten Schichten
Laufzeit vom 01.04.2009 bis 31.03.2011
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.057 / IGF-Nr.: 16.033 B
Verbesserung des Eigenschaftsprofils thermisch gespritzter Schichten aus Manganhartstählen und metastabilen austenitischen Stählen während der spanenden Bearbeitung
Laufzeit vom 01.04.2009 bis 30.09.2011
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht
2) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.060 / IGF-Nr.: 16.411 N
Qualifikation der Bestimmung der Porosität und der Eindruckhärte an thermisch gespritzten Schichten
Laufzeit vom 01.03.2010 bis 29.02.2012
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
2) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.062 / IGF-Nr.: 16.412 B
Verbesserung der Qualität lichtbogengespritzter Schichten durch den Einsatz modifizierter Brennertechnik und Hochgeschwindigkeitsgasströmungen
Laufzeit vom 01.03.2010 bis 29.02.2012
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.064 / IGF-Nr.: 17.371 B
Funktionalisierung von Keramikoberflächen durch thermisch gespritzte Schichten
Laufzeit vom 01.06.2010 bis 30.04.2013
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Keramische Technologien und Systeme I

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.065 / IGF-Nr.: 17.099 B
Oberflächenfunktionalisierung von Hochleistungspolymeren
Laufzeit vom 01.07.2011 bis 30.06.2013
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.068 / IGF-Nr.: 17.049 B
Einsatz von Fülldrähten mit großem Durchmesser für das Thermische Spritzen
Laufzeit vom 01.08.2011 bis 31.01.2014
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.069 / IGF-Nr.: 17.432 N
Entwicklung einer geeigneten Messmethode zur Untersuchung luftgetragener Schadstoffe beim Thermischen Spritzen, Bewertung der Anlagenemissionen und Ableitung von Richtlinien für den sicheren Betrieb
Laufzeit vom 01.03.2012 bis 28.02.2014
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Universitätsklinikum Aachen Medizinische Fakultät der RWTH Institut für Hygiene u. Umweltm

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.071 / IGF-Nr.: 17.025 B
Entwicklung und Qualifizierung beschichtungsgerechter CFK-Oberflächen für das Thermische Spritzen
Laufzeit vom 01.05.2012 bis 31.10.2014
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.073 / IGF-Nr.: 17.079 N
Laserunterstütztes Drehen thermisch gespritzter Metall-Matrix-Verbundwerkstoffe
Laufzeit vom 01.10.2012 bis 30.09.2014
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Fraunhofer-Institut für Produktions- technologie IPT
3) Forschungsvereinigung Programmierspra- chen für Fertigungseinrichtungen e. V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.074 / IGF-Nr.: 83.750 N
Untersuchungen zur Verbesserung des zerstörungsfreien Nachweises von Fertigungsfehlern in metallischen, thermisch gespritzten Schutzschichten
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Qualitätswesen
Vorhaben: DVS-Nr.: 02.076 / IGF-Nr.: 83.760 N
Optimieren der funktionalen Eigenschaften thermisch gespritzter Schichten durch simultanes Kugelstrahlen in inerter Prozeßatmosphäre
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 02.078 / IGF-Nr.: 86.290 N
Untersuchung der Haft- und Biegewechselfestigkeit von lichtbogen- und plasmagespritzten Verschleißschutzschichten auf Faserkunststoffverbunden
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.079 / IGF-Nr.: 86.160 N
Die Qualifizierung des autogenen Brennschneidens unter Wasser zum industriellen Zuschneiden von Formteilen aus Konstruktionsstählen
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
Vorhaben: DVS-Nr.: 02.080 / IGF-Nr.: 14.400 N
Werkstoff- und prozeßorientierte Untersuchungen zur spritztechnischen Verarbeitung von Titanhartstoffen
Laufzeit vom 01.05.1991 bis 30.04.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
Vorhaben: DVS-Nr.: 02.081 / IGF-Nr.: 33.700 N
Herstellen von Sputtertargets durch Plasmaspritzen
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 02.082 / IGF-Nr.: 93.170 N
Hochgeschwindigkeits-Flammspritzen von Molybdänschichten
Laufzeit vom 01.07.1993 bis 30.06.1995
Beteiligte Institute:
1) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg
Vorhaben: DVS-Nr.: 02.083 / IGF-Nr.: 93.160 N
Entwicklung dicker, plasmagespritzter Wärmedämmschichten zum Einsatz in der chemischen Industrie
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 02.086 / IGF-Nr.: 96.300 N
Ermittlung des Ermüdungsverhaltens von hochgeschwindigkeitsflammgespritzten WC/Co-Schichten
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 02.087 / IGF-Nr.: 96.220 N
Untersuchungen zum Zusammenhang von Plasma-, Partikel- und Schichteigenschaften mittels optischer Meßverfahren
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.088 / IGF-Nr.: 96.310 N
Autogen-Brennschneiden mit Wasserabdeckung im Dickblechbereich
Laufzeit vom 01.10.1993 bis 30.11.1995
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
Vorhaben: DVS-Nr.: 02.089 / IGF-Nr.: 17.701 N
Entwicklung und Qualifizierung des Thermischen Spritzens von FE/TiC-Schichten für ökonomische und ökologische Systemlösungen bei Hydraulikanwendungen mit wasserhaltigen Hydraulikflüssigkeiten - FeTiC Hydro
Laufzeit vom 01.03.2013 bis 28.02.2015
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.091 / IGF-Nr.: 00.091 E
Entwicklung wirtschaftlich effizienter Hartmetallbeschichtungslösungen für Hochtemperaturanwendungen CORNET
Laufzeit vom 01.04.2013 bis 31.03.2015
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Keramische Technologien und Systeme I

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.092 / IGF-Nr.: 18.153 B
Innere Hydrophobierung thermisch gespritzter Schichten
Laufzeit vom 01.04.2014 bis 30.09.2016
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.093 / IGF-Nr.: 18.088 N
Verbesserung der Schichteigenschaften beim Lichtbogendrahtspritzen durch Strommodulation
Laufzeit vom 01.03.2014 bis 30.09.2016
Beteiligte Institute:
1) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P
2) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.094 / IGF-Nr.: 18.154 B
Entwicklung von Cr2O3-Hochleistungsschichten durch thermisches Spritzen mit Suspensionen
Laufzeit vom 01.04.2014 bis 31.07.2016
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Keramische Technologien und Systeme I

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.095 / IGF-Nr.: 18.090 N
Beschichtungsrelevante Topographiekennwerte zur produktionsgerechten Substratvorbereitung für thermisch gespritzte Schichten optimierter Adhäsion – TopA
Laufzeit vom 01.03.2014 bis 30.04.2017
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.099 / IGF-Nr.: 18.963 N
Entwicklung eines Plasmaprozesses mit gepulstem Stromverlauf und angepasster Spritzwerkstoffzufuhr
Laufzeit vom 01.12.2015 bis 30.11.2017
Beteiligte Institute:
1) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.100 / IGF-Nr.: 18.788 N
Kavitationsschutzschichten aus pseudoelastischen Nickel-Titan-Legierungen hergestellt durch modifizierte Lichtbogenspritzprozesse
Laufzeit vom 01.08.2015 bis 31.07.2017
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
2) Ruhr-Universität Bochum Fakultät für Maschinenbau Institut für Werkstoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.101 / IGF-Nr.: 18.710 N
Zerstörungsfreie In-Situ-Überwachung zur Optimierung der Schichtmorphologie bei Plasma-, Lichtbogendraht- und HVOF-basierten Prozessen (OptiMorph)
Laufzeit vom 01.04.2015 bis 31.07.2017
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
2) Technische Universität Dortmund Fakultät Maschinenbau Fachgebiet für Werkstoffprüftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.102 / IGF-Nr.: 18.653 N
Ermitteln der Mechanismen zur Entstehung von Emissionen beim Thermischen Spritzen mit Fokus auf ultrafeine Partikel und die Gefährdungsbeurteilung einzelner Stäube unter produktionsrelevanten Bedingungen
Laufzeit vom 01.08.2016 bis 31.03.2019
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Universitätsklinikum Aachen AöR Institut für Arbeits-, Sozial- und Umweltmedizin

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.105 / IGF-Nr.: 19.393 N
Entwicklung eines Softwaretools (OptiSpray) zur automatisierten Bahnerzeugung, Bewegungsoptimierung und Schichtbildungssimulation beim robotergestützten thermischen Spritzen
Laufzeit vom 01.03.2017 bis 28.02.2019
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
2) Technische Universität Dortmund Fakultät für Informatik Lehrstuhl für Graphische Systeme (
3) Ruhr-Universität Bochum Lehrstuhl für Produktionssysteme

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.900 / IGF-Nr.: 15.695 B
Maßgeschneiderte keramische Schichtheizelemente, hergestellt durch thermisches Spritzen
Laufzeit vom 01.07.2008 bis 30.06.2010
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Keramische Technologien und Systeme I

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.901 / IGF-Nr.: 98.010 N
Untersuchungen zur Herstellung dünner Chromschichten durch Hochgeschwindigkeits-Flammspritz-Verfahren
Laufzeit vom 01.04.1994 bis 31.03.1996
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 02.902 / IGF-Nr.: 96.510 B
Untersuchungen zum Auftragschweißen von Kupfer mit dem PPA-Verfahren
Laufzeit vom 01.11.1993 bis 31.10.1995
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 02.904 / IGF-Nr.: 16.434 N
Weiterentwicklung eines optimierten korrosionsgeschützten Systems für niedrig legierten Baustahl mit einer tehermisch gespritzten Schutzschicht auf Basis modifizierter Zinklegierungen als Ergänzung zum Stückverzinken von Bauteilen
Laufzeit vom 01.12.2009 bis 31.03.2012
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) RWTH Aachen Institut für Eisenhüttenkunde Lehrstuhl Werkstofftechnik der Metalle
3) RWTH Aachen Lehrstuhl für Stahlbau und Leichtmetallbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 02.905 / IGF-Nr.: 00.283 Z
Neuartige thermisch applizierte Schutzschichten für korrosiv beanspruchte Anlagenkomponenten in der Müll- und Biomasseverbrennung
Laufzeit vom 01.04.2008 bis 28.02.2011
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
2) CeWOTec gGmbH

[weitere Informationen zum Projekt]
FA 3 - Lichtbogenschweißen
Vorhaben: DVS-Nr.: 03.002 / IGF-Nr.: 10.232 N
MIG-Schweißen von Reintitan und Titan-Legierungen
Laufzeit vom 01.03.1995 bis 28.02.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
Vorhaben: DVS-Nr.: 03.005 / IGF-Nr.: 96.600 B
Untersuchungen zum Betriebsverhalten und zu den Anwendungsmöglichkeiten einer kombiniert primär und sekundär getakteten, computergesteuerten Schweißstromquelle mit hoher Dynamik
Laufzeit vom 01.11.1993 bis 30.06.1996
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.009 / IGF-Nr.: 98.080 N
Untersuchungen zum Lichtbogenverhalten beim MSG-Engspaltschweißen in senkrechter Position
Laufzeit vom 01.07.1994 bis 30.06.1997
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 03.012 / IGF-Nr.: 98.050 N
Untersuchungen zum Metall-Inertgas-Impuls-Schweißen von gasarmen Aluminium-Druckguß
Laufzeit vom 01.07.1994 bis 30.06.1996
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
Vorhaben: DVS-Nr.: 03.013 / IGF-Nr.: 96.530 B
Thermosensorgeführtes MIG-Roboterschweißen von Aluminium und Aluminiumlegierungen im Raum an komplexen Bauteilen
Laufzeit vom 01.11.1993 bis 31.10.1995
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.014 / IGF-Nr.: 10.367 N
Untersuchungen zum Lichtbogenbolzenschweißen dünner Aluminiumbleche (1 bis 3 mm)
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 03.019 / IGF-Nr.: 10.368 N
MAGM-Hochleistungsschweißen mit Massiv- und Fülldrähten
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.021 / IGF-Nr.: 10.622 N
Metallschutzgasschweißen mit mehreren voneinander getrennten Drahtektroden (MAG-Tandem)
Laufzeit vom 01.03.1996 bis 28.02.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 03.023 / IGF-Nr.: 10.619 B
Erhöhung der Verschleißfestigkeit von Kupferlegierungen durch Dispergieren und Legieren mittels WIG und PTA
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 03.024 / IGF-Nr.: 10.620 B
Einfluß der Kontaktrohabstandsänderung auf die Stromhöhe/Einbrandverältnisse bei unterschiedlichen Regelprinzipien von MSG-Impulsstromquellen
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Fellbach
Vorhaben: DVS-Nr.: 03.025 / IGF-Nr.: 10.621 N
Ermittlung von praxisrelevanten Einstellbereichen für das Schweißen von Aluminium und Aluminiumlegierungen
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 03.026 / IGF-Nr.: 11.369 N
Plasmaschweißen von Aluminiumwerkstoffen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.027 / IGF-Nr.: 10.980 B
Miniradarsensor als low-cost-Sensor zur Gewährleistung der Qualität beim Schutzgasschweißen
Laufzeit vom 01.11.1996 bis 31.10.1998
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
Vorhaben: DVS-Nr.: 03.028 / IGF-Nr.: 11.002 N
Entwicklung einer Regelung zum sicheren Durchschweißen von Aluminium-Bauteilen
Laufzeit vom 01.12.1987 bis 30.11.1989
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
Vorhaben: DVS-Nr.: 03.030 / IGF-Nr.: 11.007 N
Ein Lichtbogensensor als Qualitätssicherungselement für konstante Wurzelnähte und gleichmäßiges Durchschweißen
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde Fachgebiet Fügen durch Stoffverbi
Vorhaben: DVS-Nr.: 03.031 / IGF-Nr.: 11.657 N
Untersuchungen zum Einfluss des Schutzgases auf die Stabilität des Lichtbogens und die Porenbildung beim Lichtbogenschweißen von Aluminium
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
Vorhaben: DVS-Nr.: 03.032 / IGF-Nr.: 11.656 N
Metallschutzgasschweißen von Leichtmetallwerkstoffen am Beispiel von Magnesiumlegierungen
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 03.033 / IGF-Nr.: 11.930 N
Steigerung der Wirtschaftlichkeit durch vollmechanisiertes MSG-Orbitalschweißen
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.035 / IGF-Nr.: 11.809 N
MIG/MAG-Schweißen mit sehr kurzem Lichtbogen zur Steigerung der Abschmelzleistung und Schweißgeschwindigkeit
Laufzeit vom 01.11.1998 bis 31.10.2000
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 03.038 / IGF-Nr.: 12.239 N
Reproduzierbarkeit beim MIG-Schweißen von Aluminium
Laufzeit vom 01.12.1999 bis 30.11.2001
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) Leibniz Universität Hannover Institut für Werkstoffkunde Fachgebiet Fügen durch Stoffverbi
Vorhaben: DVS-Nr.: 03.039 / IGF-Nr.: 12.240 B
Plasma-MIG-Schweißen von Aluminium und seinen Legierungen
Laufzeit vom 01.12.1999 bis 30.11.2001
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 03.043 / IGF-Nr.: 12.639 N
Untersuchungen zum Plasma-Löten von verzinkten Feinblechwerkstoffen
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.044 / IGF-Nr.: 12.473 B
Erhöhung der Prozeßstabilität beim MSG-Schweißen von hochlegierten Werkstoffen über die Drahtelektrode
Laufzeit vom 01.05.2000 bis 30.06.2002
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.046 / IGF-Nr.: 12.487 N
Entwicklung eines Auswerteprinzips für die Schweißkopfführung beim Aluminium-Impulslichtbogen-Schweißen basierend auf einer Lichtbogensensorik unter Zuhilfenahme eines künstlich neuronalen Netzes
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.047 / IGF-Nr.: 12.491 B
Effizientes WIG-Schweißen von Aluminiumwerkstoffen
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
Vorhaben: DVS-Nr.: 03.048 / IGF-Nr.: 12.757 N
MSG-Zweidrahtlöten von hochfesten beschichteten und unbeschichteten Stählen
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.050 / IGF-Nr.: 12.753 N
Lichtbogenschweißen von zylindrischen Hohlkörpern (Buchsen, Muttern etc.) mit magnetisch bewegtem Lichtbogen an Aluminiumwerkstoffen
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.051 / IGF-Nr.:
Plasmaschweißen von verzinkten und höherfesten Stahlwerkstoffen sowie von Aluminiumlegierungern im Dünnblechbereich
Laufzeit vom 01.01.2003 bis 31.12.2004
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 03.052 / IGF-Nr.: 12.751 B
Untersuchungen zur Qualifizierung des Plasma-Pulver-Verbindungsschweißens von Aluminium für den industriellen Einsatz
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.053 / IGF-Nr.: 13.004 B
MAG-Tandemschweißen mit Fülldrähten von CrNi-Stählen
Laufzeit vom 01.08.2001 bis 31.07.2003
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.054 / IGF-Nr.: 13.141 B
Untersuchungen zum MSG-Flachdraht-Schweißen von Aluminiumwerkstoffen
Laufzeit vom 01.03.2002 bis 29.02.2004
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.055 / IGF-Nr.: 13.143 N
Mechanisiertes MIG-Schweißen von Magnesiumlegierungen
Laufzeit vom 01.03.2002 bis 31.12.2004
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.056 / IGF-Nr.: 13.783 N
Qualifizierung und Nutzung der Hybrid-Synergieeffekte zum Hochleistungsschweißen von Leichtmetallwerkstoffen
Laufzeit vom 01.03.2004 bis 28.02.2006
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.057 / IGF-Nr.: 13.408 B
Untersuchungen zum MSG-Auftragsschweißen mit Flachdrahtelektroden
Laufzeit vom 01.09.2002 bis 28.02.2005
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.058 / IGF-Nr.: 13.384 B
MSG-Schweißen mit zeitlicher Veränderung von Menge und Zusammensetzung des Schutzgases
Laufzeit vom 01.01.2003 bis 31.03.2005
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.059 / IGF-Nr.: 13.784 N
Einsatz von Flachdrahtelektroden beim vollmechanisierten MSG-Schweißen von höherfesten Feinkornbaustählen
Laufzeit vom 01.03.2004 bis 31.08.2006
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.060 / IGF-Nr.: 13.483 N
Schweißtechnische und sensorische Anwendung des rotierenden Brenners
Laufzeit vom 01.02.2003 bis 31.01.2005
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.061 / IGF-Nr.: 13.484 N
Untersuchung zum MSG-Impulslichtbogenschweißen mit Zwischenimpulsen bei Anwendung von AC- und DC-Strömen
Laufzeit vom 01.06.2003 bis 31.05.2005
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.063 / IGF-Nr.: 13.771 N
Lichtbogensensorsystem zum MSG-Band-Engspaltsschweißen mit magnetischer Auslenkung des Lichtbogens
Laufzeit vom 01.10.2004 bis 30.09.2006
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.064 / IGF-Nr.: 13.862 B
Anwendung der Plasma-MIG-Technologie beim Fügen beschichteter Stahlwerkstoffe
Laufzeit vom 01.11.2004 bis 31.10.2006
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.065 / IGF-Nr.: 13.863 B
Quasi-Interner Sensor zum MIG-Schweißen
Laufzeit vom 01.02.2005 bis 31.01.2007
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.066 / IGF-Nr.: 14.425 N
Untersuchung zum MSG-Löten von mit Zink beschichteten Stahlblechen mit dem Impulslichtbogen bei Anwendungen von impulsförmigen AC- und DC-Strömen in der Grundstromphase
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.068 / IGF-Nr.: 14.426 N
Einfluss von Gasschläuchen auf die Feuchte-, Wasserstoff- und Sauerstoffproblematik in Schutzgasschweißprozessen
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.071 / IGF-Nr.: 14.459 B
Bewertung der Gesundheitsgefährdung durch Schweißrauchemissionen bei Anwendung moderner Schutzgasschweißverfahren
Laufzeit vom 01.07.2005 bis 30.06.2007
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.076 / IGF-Nr.: 15.296 N
Entwicklung eines Schweißkopfführungssystems für das automatisierte MSG-Schweißen von Stahl- und Aluminium-Legierungen
Laufzeit vom 01.08.2007 bis 31.01.2010
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.077 / IGF-Nr.:
Prozessqualifizierung für das Plasmapunktschweißen von Feinblechen
Laufzeit vom 01.10.1990 bis 30.09.1992
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.078 / IGF-Nr.: 15.562 B
Bestimmung von Wirkungsgraden moderner Schutzgasschweißverfahren
Laufzeit vom 01.07.2008 bis 30.06.2010
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.080 / IGF-Nr.: 15.231 N
Erstellung von Eigenschafts- und Bewertungsprofilen für den schweißtechnischen Einsatz von Wolframelektroden-
Laufzeit vom 01.06.2007 bis 31.05.2009
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.081 / IGF-Nr.: 15.635 N
Steigerung der Prozesssicherheit bei gleichzeitiger Verringerung der Produktionskosten durch den Einsatz gasförmiger Flussmittel beim Lichtbogenlöten
Laufzeit vom 01.08.2008 bis 31.12.2010
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht
2) Technische Universität Berlin Institut für Mechanik - Fakultät V Fachg. f. Kontinuumsmech.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.082 / IGF-Nr.: 15.774 B
Numerische und experimentelle Untersuchungen zur gezielten Beeinflussung des Lichtbogens und des Schweißbads beim Schutzgasschweißen durch die Schutzgaseigenschaften und die Schutzgaszusammensetzung
Laufzeit vom 01.09.2008 bis 31.08.2010
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.083 / IGF-Nr.: 15.745 B
Ursachen und Bewertung von Unregelmßigkeiten lichtbogengelöteter Verbindungen
Laufzeit vom 01.08.2008 bis 31.07.2010
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.084 / IGF-Nr.:
Anwendung und Weiterentwicklung des Wolfram-Plasma-Stichlochschweißens zum wirtschaftlichen und prozesssicheren Fügen von höherfesten, beschichteten Stahlblechen und Aluminiumknetlegierungen in Form von Punkt- und Liniennähten im Feinblechbereich
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.085 / IGF-Nr.: 15.859 N
Auftragschweißen von nanokristallin erstarrenden Eisenbasiswerkstoffen auf Aluminiumsubstraten mittels geregelter Kurzlichtbogentechnik
Laufzeit vom 01.11.2008 bis 30.04.2011
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.086 / IGF-Nr.: 16.028 B
Erhöhung der Prozessstabilität beim MSG-Schweißen durch modifizierte Schutzgasströmung
Laufzeit vom 01.04.2009 bis 31.03.2011
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.087 / IGF-Nr.: 15.914 B
Einsatz von neuen Nicht-Kupferwerkstoffen zur Schweißdrahtkontaktierung in MSG-Schweiß- und Lötprozessen, insbesondere für Aluminium und niedrigschmelzende Zusatzwerkstoffe
Laufzeit vom 01.12.2008 bis 30.11.2010
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.088 / IGF-Nr.: 15.916 N
vollmechanisiertes Schweißsystem zum Wurzelschweißen von V- und X-Nahtvorbereitungen mit modernen geregelten Lichtbogenverfahren und digitaler Kurzschlussauflösung
Laufzeit vom 01.12.2008 bis 30.11.2010
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.090 / IGF-Nr.: 15.871 B
Strömungstechnische Auslegung von Brennersystemen zum wirtschaftlichen und emissionsreduzierten Lichtbogenschweißen CLUSTER
Laufzeit vom 01.11.2008 bis 31.12.2011
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.091 / IGF-Nr.: 15.872 B
Entwicklung einer ereignisorientierten Regelung auf Basis der inversen Modellierung zur robusten Prozessführung komplexer MSG-Impulsschweißprozesse CLUSTER
Laufzeit vom 01.11.2008 bis 31.10.2011
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) Brandenburgische Technische Universität Cottbus - Senftenberg (BTU CS)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.093 / IGF-Nr.: 16.172 N
Modifikation des Elektrogasschweißens zur Verringerung der Wärmeeinbringung
Laufzeit vom 01.08.2009 bis 31.07.2011
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.095 / IGF-Nr.: 16.557 N
Schweißeignungsuntersuchungen an hochfesten Feinkornbaustählen beim Einsatz neuer Sprühlichtbogenprozesse
Laufzeit vom 01.09.2010 bis 31.08.2012
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.097 / IGF-Nr.: 16.779 B
Wirtschaftliches WIG-Fügen durch magnetisches Pendeln des Lichtbogens
Laufzeit vom 01.11.2010 bis 31.01.2013
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.098 / IGF-Nr.: 16.414 B
Plasma-Hybrid-Schweißen mit integriertem Laser und Sensorik - PiLS -
Laufzeit vom 01.03.2010 bis 31.08.2012
Beteiligte Institute:
1) INP Greifswald e. V. Leibniz-Institut für Plasmaforschung und Technologie e. V.
2) Technische Universität Hamburg-Harburg Institut für Laser- und Anlagen- systemtechnik (iLA

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.101 / IGF-Nr.: 16.954 N
Entwicklung einer Online-Schmelzbaddiagnostik zur Schweißnahtqualitätsüberwachung und zur Vermeidung von Schweißnahtfehlern beim Lichtbogenschweißen
Laufzeit vom 01.07.2011 bis 30.06.2013
Beteiligte Institute:
1) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.105 / IGF-Nr.: 17.351 N
Unterpulver-Impulsschweißen zur Reduzierung des Wasserstoffeintrages beim Schweißen hochfester Feinkornbaustähle
Laufzeit vom 01.12.2011 bis 31.05.2014
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.106 / IGF-Nr.: 17.431 B
Steigerung der Wirtschaftlichkeit von MSG-Schweißprozessen durch konsequente Nutzung der Potentiale von Prozessgasen
Laufzeit vom 01.03.2012 bis 28.02.2014
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
2) INP Greifswald e. V. Leibniz-Institut für Plasmaforschung und Technologie e. V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.107 / IGF-Nr.: 18.458 B
Entwicklung eines AC-MSG-Schweißverfahrens zum Fügen hochfester Feinkornbaustähle
Laufzeit vom 01.12.2014 bis 31.05.2017
Beteiligte Institute:
1) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P
2) Brandenburgische Technische Universität Cottbus - Senftenberg (BTU CS)
3) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.108 / IGF-Nr.: 17.749 B
Einfluss der Fugengeometrie und der Schweißposition auf den Wärmeeintrag ins Bauteil beim Schutzgasschweißen
Laufzeit vom 01.01.2014 bis 30.04.2016
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.109 / IGF-Nr.: 17.885 N
Steuerung der Aufmischung beim Auftragschweißen mit hoher Abschmelzleistung durch modifizierte Zweidrahtprozesse
Laufzeit vom 01.01.2014 bis 28.02.2017
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.110 / IGF-Nr.: 17.844 B
Metallschutzgasschweißen von pressgehärteten höchstfesten Stählen mit unterschiedlichen Beschichtungskonzepten
Laufzeit vom 01.07.2013 bis 30.06.2015
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.111 / IGF-Nr.: 17.923 N
Sensorgestütztes MSG-Engspaltschweißen von Feinkornstählen mit modifizierter Prozessführung im Dickblechbereich
Laufzeit vom 01.01.2014 bis 31.07.2016
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.112 / IGF-Nr.: 18.147 N
Verbesserung der Wirtschaftlichkeit des UP-Schweißens durch Plasmaunterstützung
Laufzeit vom 01.02.2016 bis 31.07.2018
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.113 / IGF-Nr.: 17.969 B
Bewertung von Einflussfaktoren auf den Wärmeeintrag beim Schweißen mit modernen energiedynamischen MSG-Verfahrensvarianten
Laufzeit vom 01.01.2014 bis 31.12.2015
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.114 / IGF-Nr.: 18.089 B
Erarbeiten einer Strategie zum effizienten MSG-Fülldrahtauftragschweißen hart-stoffverstärkter Verschleißschutzschichten mittels magnetisch beeinflusstem Lichtbogen
Laufzeit vom 01.03.2014 bis 30.09.2016
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.115 / IGF-Nr.: 18.021 B
Qualifizierung und Weiterentwicklung von Schleppgasdüsen für eine verbesserte Schutzgasabdeckung beim Schweißen
Laufzeit vom 01.01.2014 bis 31.12.2015
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.116 / IGF-Nr.: 19.203 N
Serielles Plasma-MSG-Hybridschweißen bei Verwendung angepasster Prozessvarianten zum wirtschaftlichen Fügen von Aluminium
Laufzeit vom 01.10.2016 bis 31.03.2019
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.119 / IGF-Nr.: 18.008 B
Metall-Schutzgas-Tandemschweißen mit mittiger Hartstoffeinbringung zum Herstellen gradierter Verschleißschutzschichten
Laufzeit vom 01.11.2014 bis 31.12.2016
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
2) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.120 / IGF-Nr.: 18.579 B
Steigerung der Prozesssicherheit bei UP-Verfahrensvarianten mittels optischer Analysen des Lichtbogens und des Werkstoffübergangs im Kavernenraum
Laufzeit vom 01.01.2015 bis 31.05.2017
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Einrichtung für Großstrukturen in der Produktionst
2) INP Greifswald e. V. Leibniz-Institut für Plasmaforschung und Technologie e. V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.123 / IGF-Nr.: 18.748 N
Untersuchung zur Erhöhung der Prozesssicherheit und Wirtschaftlichkeit beim MSG-Schweißen durch Laserstabilisierung
Laufzeit vom 01.08.2015 bis 31.01.2018
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.126 / IGF-Nr.: 18.585 B
Entwicklung einer additiven Herstellungsmethode für Verbundstrukturen mittels MSG-Lichtbogentechnik
Laufzeit vom 01.07.2016 bis 30.09.2018
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.800 / IGF-Nr.: 00.157 E
Strukturierung von Aluminiumoberflächen mit anodischem WIG-Lichtbogenprozess (Im Cornet-Verbundprojekt MeTexCom 2: Entwicklung von Metall-Textil-Verbünden mit verbessertem Adhäsisionsverhalten)
Laufzeit vom 01.04.2016 bis 31.03.2018
Beteiligte Institute:
1) Sächsisches Textilforschungs- institut e.V. (STFI)
2) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
3) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 03.900 / IGF-Nr.: 14.938 N
Integration und Überwachung des Schweißens von Normteilen in Blech-Verbundwerkzeuge
Laufzeit vom 01.06.2007 bis 31.05.2009
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Umformtechnik und Umformmaschinen
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 03.982 / IGF-Nr.: 96.320 N
Elektromagnetische Verträglichkeit: Untersuchung von Fehlfunktionen elektronischer Steuerungen beim HF-Zünden von WIG-Schweißprozessen
Laufzeit vom 01.05.1993 bis 30.04.1995
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde Fachgebiet Fügen durch Stoffverbi
Vorhaben: DVS-Nr.: 03.983 / IGF-Nr.: 93.090 N
Zum Prozeßverhalten beim MAG-Hochleistungsschweißen nach dem T.I.M.E.-Verfahren
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.984 / IGF-Nr.: 33.400 D
Entwicklung und Erprobung einer WIG-Wechselstrom-Verfahrensvariante zum Schweißen dünner Bleche
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f
2) Leibniz Universität Hannover Institut für Werkstoffkunde
Vorhaben: DVS-Nr.: 03.985 / IGF-Nr.: 82.370 N
Untersuchungen zur Verbesserung der Standzeit von Stromkontaktdüsen zum Metallschutzgasschweißen
Laufzeit vom 01.10.1990 bis 30.09.1992
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 03.996 / IGF-Nr.: 93.080 N
Quasi-Echtzeitmessung der Temperaturverteilung im WIG-Lichtbogen und Impulslichtbogen
Laufzeit vom 01.01.1993 bis 31.12.1995
Beteiligte Institute:
1) Universität der Bundeswehr München Fakultät f.Elektro-u.Informationstechnik Institut für P
Vorhaben: DVS-Nr.: 03.997 / IGF-Nr.: 93.060 N
Untersuchungen zum WIG-Schweißen mit rechteckförmigem Wechselstrom (richtige DVS-Nr. 3.081)
Laufzeit vom 01.05.1993 bis 30.04.1995
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 03.998 / IGF-Nr.: 95.950 N
Grundlagenuntersuchungen zum Prozeßverhalten beim Metall-Schutzgasschweißen mit schnell rotierendem Schweißbrenner
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 03.999 / IGF-Nr.: 86.190 N
Untersuchungen zum Zündverhalten und zur Standzeit von Elektroden für das WIG-Schweißen (richtige DVs-Nr. 3.078)
Laufzeit vom 01.06.1991 bis 30.04.1994
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde Fachgebiet Fügen durch Stoffverbi
Vorhaben: DVS-Nr.: I2.013 / IGF-Nr.: 17.942 N
Entwicklung und Qualifizierung einer modifizierten äquivalenten Wärmequelle für die Simulation der Wärmeeinbringung beim Lichtbogenschweißen
Laufzeit vom 01.01.2014 bis 31.08.2016
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
FA 4 - Widerstandsschweißen
Vorhaben: DVS-Nr.: / IGF-Nr.:
Grundlegende Untersuchung zur Kontaktsituation beim Widerstandspunktschweißen
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 04.001 / IGF-Nr.: 98.210 N
Aufbau und Erprobung eines 3D-Prozeßanalysesystems für das Widerstandsschweißen auf Basis des numerischen Simulationsprogrammes „CARE-WELD“
Laufzeit vom 01.06.1994 bis 31.05.1996
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 04.002 / IGF-Nr.: 98.090 N
Ermitteln der Möglichkeiten einer Qualitätssicherung beim Widerstandspunktschweißen von Aluminiumwerkstoffen durch Einsatz der Mikrofokus-Durchstrahlungstechnik“
Laufzeit vom 01.03.1994 bis 29.02.1996
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
Vorhaben: DVS-Nr.: 04.006 / IGF-Nr.: 10.289 N
Einsatz Neuronaler Netze zur Qualitätssicherung beim Widerstandspunktschweißen
Laufzeit vom 01.07.1995 bis 30.06.1997
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 04.007 / IGF-Nr.: 10.399 N
Beurteilung der schweißtechnischen und lärmmindernden Eigenschaften von neuen servopneumatischen und servoelektrischen Krafterzeugungssystemen zum Widerstandspunkt- und -buckelschweißen im Vergleich zu konventionellen pneumatischen und wasserhydraulischen
Laufzeit vom 01.10.1995 bis 30.09.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 04.008 / IGF-Nr.: 10.330 N
Untersuchungen der Zähigkeitseigenschaften von schmalen Verfahrenseinflusszonen, wie sie vor allem beim Press-Schweißen entstehen
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
Vorhaben: DVS-Nr.: 04.010 / IGF-Nr.: 10.630 N
Untersuchung der Verbindungsbildung beim Widerstandspunkt-schweißen blanker und metallisch überzogener Kupferlegierungen
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 04.011 / IGF-Nr.: 10.707 N
Untersuchungen zum Qualitätsvergleich von quetschnaht- und laserstrahlgeschweißten Feinblechwerkstoffen unter Einbindung der Folgeprozesse Nachglätten und Wärmebehandeln
Laufzeit vom 01.06.1996 bis 31.05.1998
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 04.012 / IGF-Nr.: 11.374 N
Qualifizierung von piezoelektrischen Aktoren als Nachsetzelemente für die Widerstandsschweißtechnik
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 04.013 / IGF-Nr.: 11.371 N
Entwicklung einer Methodik zur Optimierung der Schweißparameter beim Widerstandsschweißen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 04.014 / IGF-Nr.: 11.373 N
Erarbeitung einer Technologie zum Herstellen von zweischnittigen Punktschweißverbindungen („3-Blech-Schweißung“)
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 04.015 / IGF-Nr.: 11.379 B
Untersuchungen zur elektromagnetischen Verträglichkeit von Widerstandsschweißmaschinen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.017 / IGF-Nr.: 11.471 N
Untersuchung der Punktschweißeignung organisch beschichteter Stahlbleche
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 04.019 / IGF-Nr.: 12.188 B
Prozesssimulation und Untersuchung zur Entstehung von Flüssigphasen beim Widerstandsbuckelschweißen von Kupferlegierungen
Laufzeit vom 01.12.1999 bis 30.11.2001
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
2) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 04.021 / IGF-Nr.: 12.147 B
EMVU-relevante Feldemissionen von Widerstandsschweißmaschinen
Laufzeit vom 01.11.1999 bis 31.10.2001
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.023 / IGF-Nr.: 12.617 N
Grundlegende Untersuchung zur Kontaktsituation beim Widerstandspunktschweißen
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.024 / IGF-Nr.: 12.616 N
Widerstandspunkt- und Buckelschweißen von Magnesiumlegierungen
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.025 / IGF-Nr.: 12.618 N
Untersuchungen zum Widerstandspunktschweißen von Feinblechen aus neuentwickelten höher- und höchstfesten Stahlwerkstoffen
Laufzeit vom 01.10.2000 bis 31.12.2002
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.026 / IGF-Nr.: 12.739 N
Einseitiges Widerstandsschweißen von Stahl-Hohlprofilen
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.027 / IGF-Nr.: 12.935 N
Widerstandsschweißen von höher kohlenstoffhaltigen Stählen mit sehr kurzer Wärmeeinbringung
Laufzeit vom 01.07.2001 bis 30.06.2003
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.030 / IGF-Nr.: 13.142 B
Untersuchungen zur schweißtechnischen Verarbeitung von Al-Sandwich-Verbunden
Laufzeit vom 01.03.2002 bis 29.02.2004
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.031 / IGF-Nr.: 13.134 N
Standmengenerhöhung beim Widerstandspunktschweißen durch Elektrodenfräsen
Laufzeit vom 01.03.2002 bis 29.02.2004
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
2) Materialprüfungsanstalt (MPA) Universität Stuttgart

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.032 / IGF-Nr.: 13.284 B
Verringerung der elektromagnetischen Störemissionen von Widerstandsschweißmaschinen durch leistungsteilinterne Maßnahmen
Laufzeit vom 01.05.2002 bis 30.04.2004
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.033 / IGF-Nr.: 13.568 N
Vergleichende Untersuchung innovativer Geräte zur Verbesserung der Schweißqualität beim Widerstandspunktschweißen
Laufzeit vom 01.02.2003 bis 31.01.2005
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.036 / IGF-Nr.: 13.773 N
Untersuchung des Beschichtungseinflusses beim Indirekt-Kurzzeit-Schweißen von einseitig kunststoffbeschichteten Stahlblechen
Laufzeit vom 01.06.2003 bis 31.05.2005
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.038 / IGF-Nr.: 14.927 N
Untersuchungen zu den werkstoffspezifischen Versagensmechanismen von Widerstandspunktschweißungen unter Crash- und Ermüdungs-beanspruchungen
Laufzeit vom 01.08.2006 bis 31.01.2009
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.039 / IGF-Nr.: 14.435 N
Untersuchungen zum Anschweißen von Widerstandsschweißmuttern an Blechen aus höher- bis höchstfesten Werkstoffen
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.040 / IGF-Nr.: 14.573 N
Untersuchung des Bruchverhaltens von Wirderstandspunktschweißun-gen an höherfesten Stählen
Laufzeit vom 01.04.2006 bis 31.03.2008
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.042 / IGF-Nr.: 14.818 B
Beurteilung und Beeinflussung von Magnetfeldexpositionen beim Widerstandsschweißen
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.043 / IGF-Nr.: 15.295 N
Bestimmung des Einflusses von fertigungsbedingten Imperfektionen und betriebsbedingten Eigenschaftsänderungen auf die Festigkeit von Punktschweißverbindungen unter Crashbelastung
Laufzeit vom 01.08.2007 bis 31.07.2009
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.044 / IGF-Nr.: 15.115 B
Untersuchungen zur Erhöhung der Qualität beim Widerstandspunkt-schweißen von hoch- und höchstfesten sowie hochlegierten austenitischen Stählen
Laufzeit vom 01.02.2007 bis 31.01.2009
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.045 / IGF-Nr.: 15.534 N
Optimierung der Geometrie geprägter Buckel für das Widerstandsbuckelschweißen an höher- bis höchstfesten Stahlwerkstoffen
Laufzeit vom 01.03.2008 bis 28.02.2010
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.046 / IGF-Nr.: 15.710 N
Grundlegende Untersuchung zur Kontaktsituation beim Widerstandsschweißen von Kupferwerkstoffen
Laufzeit vom 01.07.2008 bis 31.10.2010
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.047 / IGF-Nr.: 16.096 N
Entwicklung eines geeigneten Elektrodenbearbeitungsverfahrens für das Widerstandspunktschweißen von Aluminiumwerkstoffen
Laufzeit vom 01.06.2009 bis 31.05.2011
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.048 / IGF-Nr.: 16.140 N
Einfluss der mechanisch/dynamischen Maschineneigenschaften beim Widerstandspunktschweißen mit Schweißzangen
Laufzeit vom 01.07.2009 bis 31.03.2012
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.049 / IGF-Nr.: 16.334 N
Möglichkeiten zur Beeinflussung der Einschmelztiefe sowie der Linsenposition beim Widerstandspunktschweißen asymmetrischer Mehrblechkombinationen mit normal- und höherfesten Stahlblechen
Laufzeit vom 01.01.2010 bis 30.06.2012
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.050 / IGF-Nr.: 16.335 N
Verbesserung der Prozesssicherheit des Punktschweißklebens von Aluminiumwerkstoffen und Ermittlung von Verbindungskennwerten für Konstruktion und Simulation
Laufzeit vom 01.01.2010 bis 30.06.2012
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.052 / IGF-Nr.: 16.776 B
Referenzsystem für die Berechnung von elektrischen Gewebefeldstärken (Stromdichten) im menschlichen Körper beim Widerstandsschweißen
Laufzeit vom 01.11.2010 bis 31.05.2013
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.054 / IGF-Nr.: 17.395 B
Entwicklung von Anwendungsrichtlinien zum Litzenkompaktieren und -schweißen
Laufzeit vom 01.01.2012 bis 31.12.2013
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.055 / IGF-Nr.: 17.528 N
Einfluss von fertigungsbedingten Spalten auf das Tragverhalten von Widerstandspunktschweißverbindungen aus hochfesten Stählen
Laufzeit vom 01.11.2012 bis 30.04.2015
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.056 / IGF-Nr.: 17.685 N
Untersuchung und Qualifizierung der verfahrensspezifischen Merkmale beim einseitigen Widerstandspunktschweißen ohne Gegenlage
Laufzeit vom 01.04.2013 bis 30.09.2015
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.057 / IGF-Nr.: 17.621 B
Rollennahtschweißen strukturierter Feinbleche
Laufzeit vom 01.12.2012 bis 31.05.2015
Beteiligte Institute:
1) Brandenburgische Technische Universität Cottbus-Senftenburg Lehrstuhl Füge- und Schweißtec
2) TIME Technologie-Institut für Metall & Engineering GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.058 / IGF-Nr.: 17.539 B
Zerstörungsfreie Bewertung des Linsendurchmessers beim Widerstandspunktschweißen mit magnetischen Prüfverfahren
Laufzeit vom 01.12.2012 bis 30.11.2014
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.059 / IGF-Nr.: 17.789 N
Einfluss von Punktdurchmesser, Fehlstellen und Imperfektionen auf das Festigkeitsverhalten von Aluminiumpunktschweißverbindungen
Laufzeit vom 01.07.2013 bis 30.11.2015
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
2) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Produktions- anlagen u. Konstruktions

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.061 / IGF-Nr.: 18.159 B
Einfluss von Reparaturbedingungen auf mechanisch-technologische Eigenschaften von Widerstandspunktschweißverbindungen
Laufzeit vom 01.04.2014 bis 30.06.2016
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
2) Hochschule Anhalt Fachbereich EMW - Spanlose Fertigung

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.062 / IGF-Nr.: 18.456 B
Lebensdauererhöhung von Widerstandspunktschweißelektroden durch Einsatz verschleißabhängiger Fräsintervalle und dispersionsgehärteter Kupferwerkstoffe
Laufzeit vom 01.07.2015 bis 30.09.2017
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.069 / IGF-Nr.: 18.987 B
Erwärmungsverhalten der Kontaktzone beim Kondensatorentladungsschweißen unter Berücksichtigung der dynamischen Stromänderung und des Nachsetzverhaltens der Elektroden
Laufzeit vom 01.01.2016 bis 31.12.2017
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.070 / IGF-Nr.: 19.208 B
Zerstörungsfreie Charakterisierung der Anbindungsfläche beim Widerstandspressschweißen durch bildgebende Analyse der Remanenzflussdichte
Laufzeit vom 01.10.2016 bis 30.09.2018
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.071 / IGF-Nr.: 18.581 N
Untersuchungen zum Widerstandsbuckelschweißen zur Erzeugung elektrischer Al-Cu-Kontaktierungen
Laufzeit vom 01.07.2016 bis 31.03.2019
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.179 / IGF-Nr.: 76.810 N
Entwicklung Aufbau und Erprobung eines Systems zur Ermittlung der Widerstandspunkt- schweißeignung mit abschließendem Einsatz am Beispiel verzinkter Stahlbleche
Laufzeit vom 01.10.1988 bis 30.09.1991
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 04.187 / IGF-Nr.: 86.180 N
Untersuchungen zur Eignung des Reibschweißens zum Verbinden von wärmebehandelten Bauteilkomponenten
Laufzeit vom 01.06.1991 bis 31.05.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 04.188 / IGF-Nr.: 86.230 N
Ermittlung der Einsatzbereiche und Einsatzgrenzen von Geräten zur Qualitätssicherung beim Widerstandspunktschweißen
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 04.189 / IGF-Nr.: 93.130 N
Reibschweißen von unterschiedlichen Querschnitten
Laufzeit vom 01.05.1993 bis 30.04.1995
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 04.191 / IGF-Nr.: 10.000 Q
Qualitätssicherung durch numerische Analyse der mechanischen und thermischen Prozesse beim Widerstandspunktschweißen
Laufzeit vom 01.07.1990 bis 30.06.1992
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 04.192 / IGF-Nr.: 28.000 D
Untersuchungen zum Erstellen von optimalen Schweißtechnologien für das Reibschweißen unter besonderer Beachtung des Umwandlungsverhaltens
Laufzeit vom 01.12.1990 bis 28.02.1993
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Mecklenburg-Vorpommern GmbH
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 04.193 / IGF-Nr.: 60.000 D
Nachweis einer erweiterten Parameterwahl beim Widerstandspunkt- und Rollennahtschweißen von AlLi-Legierungen im Vergleich zu herkömmlichen Al-Legierungen
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
Vorhaben: DVS-Nr.: 04.194 / IGF-Nr.: 12.000 D
Grundlagen für ein Beratungssystem Reibschweißen (computergestützt und manuell)
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 04.195 / IGF-Nr.: 13.700 D
Vergleichende Untersuchung der Fügeverfahren Löten, Diffusionsschweißen und Widerstandsschweißen beim Fügen von Hartmetallen mit Stahl
Laufzeit vom 01.05.1991 bis 30.04.1993
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
2) Technische Universität Ilmenau FG Plasma u. Oberflächentechnik
Vorhaben: DVS-Nr.: 04.196 / IGF-Nr.: 29.200 D
Ermitteln der Möglichkeiten einer Qualitätssicherung beim Widerstandspunktschweißen von Aluminiumwerkstoffen durch Einsatz der Mikrofokus-Durchstrahlungstechnik
Laufzeit vom 01.06.1991 bis 31.05.1993
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
Vorhaben: DVS-Nr.: 04.197 / IGF-Nr.: 93.110 N
Untersuchungen zur Eignung unlegierter und niedriglegierter Stähle zum Abbrennstunmpf- und Pressstumpfschweißen
Laufzeit vom 01.06.1993 bis 31.05.1995
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Konstruktionstechnik (IK)
Vorhaben: DVS-Nr.: 04.198 / IGF-Nr.: 95.970 N
Entwicklung einer durch Prägen herstellbaren Buckelgeometrie für das Kondensator Impuls-Schweißen von Stahlwerkstoffen
Laufzeit vom 01.10.1993 bis 31.03.1996
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 04.199 / IGF-Nr.: 93.140 N
Bestimmung der zur Legierungsschichtbildung führenden Wirkungsmechanismen und deren Auswirkungen auf den Elektrodenverschleiß beim Schweißen feuerverzinkter Stahlbleche
Laufzeit vom 01.06.1993 bis 31.05.1995
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 04.200 / IGF-Nr.: 92.370 B
Ermittlung der Eignung der in den fünf neuen Ländern vorhandenen Widerstandsschweißmaschinen zum Punktschweißen von Aluminiumwerkstoffen
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
Vorhaben: DVS-Nr.: 04.999 / IGF-Nr.: 18.409 B
Verfahrensentwicklung zur Herstellung von hybriden FVK/Stahl Strukturen mittels eines neuartigen Blechverbindungselementes – „HyBVE“
Laufzeit vom 01.05.2015 bis 31.08.2017
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Werkzeugmaschinen und Fertigungstechnik
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
FA 5 - Sonderschweißverfahren
Vorhaben: DVS-Nr.: 05.001 / IGF-Nr.: 15.687 N
Untersuchung des konduktiv unterstützten Rührreibschweißens an Stahl- und Aluminium
Laufzeit vom 01.07.2008 bis 31.12.2010
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.002 / IGF-Nr.: 15.688 N
Erarbeitung von Konzepten zur Bewertung der Eignung von Anlagen für das Rührreibschweißen sowie zur Übertragsbarkeit von Schweißparametern
Laufzeit vom 01.07.2008 bis 31.12.2010
Beteiligte Institute:
1) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (
2) Materialprüfungsanstalt (MPA) Universität Stuttgart

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.003 / IGF-Nr.: 15.689 B
Entwicklung einer online Prozesskontrolle für das Rührreibschweißen auf der Basis einer werkzeugintegrierten Sensorik
Laufzeit vom 01.07.2008 bis 31.12.2010
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.004 / IGF-Nr.: 10.366 N
Einfluss der Legierungselemente und des Auslagerungszustandes auf die mechanisch-technologischen Eigenschaften beim Reibschweißen von aushärtbaren Aluminiumlegierungen
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 05.008 / IGF-Nr.: 10.730 N
Preßschweißen mit magnetisch bewegtem Lichtbogen (MBP) der Werkstoffkombination Stahl mit Späroguß im Bereich großer Wanddicken (4-7mm)
Laufzeit vom 01.07.1996 bis 30.06.1998
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 05.009 / IGF-Nr.: 11.375 N
Schweißen zylindrischer Hohlkörper auf ungelochte und gelochte Bleche mittels magnetisch bewegtem Lichtbogen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 05.010 / IGF-Nr.: 11.378 N
Vergleichende Untersuchung zum Ultraschall-, Reib-, Laserstrahl- und Widerstandspressschweißen von NiTi-Shape-Memory-Metall mit hochlegierten Stählen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 05.012 / IGF-Nr.: 11.533 B
Untersuchungen zum Einsatz des Diffusionsschweißens mit Interlayer bei niedrigen Temperaturen für das stoffschlüssige Verbinden temperaturempfindlicher Werkstoffe und zur Kapselung temperaturempfindlicher Baugruppen
Laufzeit vom 01.04.1998 bis 31.03.2000
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
Vorhaben: DVS-Nr.: 05.013 / IGF-Nr.: 11.655 B
Die Beeinflussung der Ultraschallschweißeignung elektrischer Kupferleiter durch Oberflächenschichten und Lackisolierungen
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.014 / IGF-Nr.: 11.659 N
Bolzensetzen von Stahl- und Aluminiumwerkstoffen
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 05.015 / IGF-Nr.: 11.932 B
Fügen von ausgewählten Werkstoffkombinationen mittels Gradientenfolien
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
Vorhaben: DVS-Nr.: 05.017 / IGF-Nr.: 12.174 B
Klassifizierung und Bewertung metallischer Beschichtungen beim Ultraschallschweißen von Metallkombinationen in der Elektronik
Laufzeit vom 01.10.1999 bis 30.09.2001
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
Vorhaben: DVS-Nr.: 05.019 / IGF-Nr.: 12.494 B
Untersuchung zum unltraschallunterstützten Kaltpreßschweißen für Anwendung in der Kleinteilfertigung
Laufzeit vom 01.06.2000 bis 30.09.2002
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.020 / IGF-Nr.: 12.738 N
Untersuchungen des Einflusses hoher Drehzahlen auf das Schweißergebnis für das Reibschweißen mit niedrigen Prozeßkräften
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.021 / IGF-Nr.: 12.495 N
Reib- und Bolzenschweißen von Verbindungselementen mit metallischen Schäumen
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
Vorhaben: DVS-Nr.: 05.022 / IGF-Nr.: 12.937 N
Entwicklung eines Qualitätssicherungssystems für das Ultraschallschweißen auf Basis neuronaler Netze unter Nutzung der von der Maschine zur Verfügung gestellten Messwerte.
Laufzeit vom 01.07.2001 bis 30.06.2003
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.024 / IGF-Nr.: 13.331 B
Fügen optischer Komponenten für Hochleistungsoptiken, für die Vakuumtechnik und für Laseranwendungen
Laufzeit vom 01.06.2002 bis 31.05.2004
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.025 / IGF-Nr.: 12.936 N
Reibschweißen mit zusätzlicher Wärmequelle
Laufzeit vom 01.07.2001 bis 30.06.2003
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.026 / IGF-Nr.: 13.250 N
Erprobung der Durchschweißtechnik beim Lichtbogenbolzenschweißen mit Hubzündung an unterschiedlich beschichteten Stahlblechen
Laufzeit vom 01.04.2002 bis 31.03.2004
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.027 / IGF-Nr.: 13.285 N
Untersuchungen zur Vermeidung bzw. Reduzierung des Anhaftens von Aluminium und Aluminiumlegierungen an Sonotroden beim Ultraschall- schweißen
Laufzeit vom 01.05.2002 bis 30.04.2004
Beteiligte Institute:
1) Technische Universität Kaiserslautern Lehrstuhl für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.028 / IGF-Nr.: 13.362 N
Bolzenschweißen an beschichteten Blechen
Laufzeit vom 01.08.2002 bis 31.07.2004
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.029 / IGF-Nr.: 13.594 B
Entwicklung zur Verfahrenskombination Reibschweißen und Umformen
Laufzeit vom 01.03.2003 bis 28.02.2005
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.030 / IGF-Nr.: 13.597 N
Optimierung der Verbindungsqualität und Ermittlung von verbesserten Prüfkriterien artfremder Schwarz-Weiß Bolzenschweißverbindungen
Laufzeit vom 01.06.2003 bis 31.05.2005
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.031 / IGF-Nr.: 13.984 N
Weiterentwicklung des Bolzenschweißens in halbnasser Umgebung zur industriellen Anwendbarkeit mit Verbindungsprüfung zur Qualitätssicherung
Laufzeit vom 01.02.2005 bis 31.01.2007
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.032 / IGF-Nr.: 13.772 B
Technologie zum Herstellen von Werkzeugen zum Mikrospritzgießen durch Diffusionsschweißen
Laufzeit vom 01.08.2003 bis 31.07.2005
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.033 / IGF-Nr.: 14.537 N
Untersuchungen zum plastischen Fügen von Mischverbindungen mit speziell konturierter Kegelgeometrie
Laufzeit vom 01.02.2006 bis 31.01.2008
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.034 / IGF-Nr.: 14.572 B
Untersuchungen zur Übertragbarkeit der Prozessparameter auf Anlagen unterschiedlicher Bauart bem Herstellen von Tailored Blanks auf geschlossener Bahn mittels Rührreibschweißen
Laufzeit vom 01.09.2005 bis 31.08.2007
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik
2) Materialprüfungsanstalt (MPA) Universität Stuttgart

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.035 / IGF-Nr.: 14.881 N
Qualitätsbeurteilung von Bolzenschweißverbindungen mit Hubzündung durch Prozeßüberwachung
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.036 / IGF-Nr.: 14.574 N
Rührreibschweißen von Stahl und Stahl-Werkstoffkombinationen mit lokaler induktiver Erwärmung
Laufzeit vom 01.04.2006 bis 30.06.2008
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.037 / IGF-Nr.: 14.928 B
Entwicklung einer Fügetechnologie zum Herstellen von Mischverbindungen mit Titanwerkstoffen bei niedrigen Temperaturen
Laufzeit vom 01.08.2006 bis 31.07.2008
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.038 / IGF-Nr.: 14.962 N
Untersuchungen zum Orbitalreibschweißen von metallischen Werkstoffen und Mischverbindungen an nichtrotationssymmetrischen Verbindungsquerschnitten
Laufzeit vom 01.01.2007 bis 31.12.2008
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.039 / IGF-Nr.: 15.112 N
Metall-Ultraschallschweißen von flexiblen Flachbandkabeln
Laufzeit vom 01.02.2007 bis 31.01.2009
Beteiligte Institute:
1) Technische Universität Kaiserslautern Lehrstuhl für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.040 / IGF-Nr.: 15.233 B
Entwicklung einer Technologie zum Fügen bei niedrigen Temperaturen durch die kombinatorische Nutzung von Größeneffekten und exothermen Reaktionen
Laufzeit vom 01.06.2007 bis 30.11.2009
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.041 / IGF-Nr.: 15.317 N
Reibpunktschweißen von Überlappverbindungen an Aluminiumknet- und -gusslegierungen im Vergleich
Laufzeit vom 01.09.2007 bis 31.05.2010
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.042 / IGF-Nr.: 16.278 N
Schockschweißverfahren – wirtschaftliches Fügen für industrielle Anwendungen
Laufzeit vom 01.12.2009 bis 30.09.2013
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.043 / IGF-Nr.: 16.318 N
Qualifizierung des Friction-Stir-Welding für das Fügen von Aluminium-Druckguss-Komponenten
Laufzeit vom 01.01.2010 bis 31.12.2011
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.044 / IGF-Nr.: 17.147 N
Untersuchungen zum klebstofffixierten Rührreibschweißen von überlappenden Aluminium-Blechen "Bond-WELD"
Laufzeit vom 01.07.2012 bis 31.12.2014
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.045 / IGF-Nr.: 00.040 E
Investigations on magnetic pulse crimping of tubular overlap joints with and without filler material
Laufzeit vom 01.07.2010 bis 31.12.2012
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.047 / IGF-Nr.: 17.394 N
Optimierung von Schweißparametern beim Schwungradreibschweißen
Laufzeit vom 01.09.2012 bis 31.05.2015
Beteiligte Institute:
1) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.048 / IGF-Nr.: 17.489 N
Untersuchungen zur Verringerung der Winkelstellung beim Lichtbogenbolzenschweißen mit Hubzündung
Laufzeit vom 01.05.2012 bis 30.04.2014
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.049 / IGF-Nr.: 17.617 N
Entwicklung einer fertigungsintegrierbaren zerstörungsfreien Prüftechnik für punkt- und linienförmig rührreibgeschweißte Strukturbauteile mittels thermografischer Methoden
Laufzeit vom 01.01.2013 bis 30.04.2015
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.050 / IGF-Nr.: 17.556 N
HIGHspeed FSW - Deutliche Erhöhung der Schweißgeschwindigkeit beim Rührreibschweißen mittels konduktiver Erwärmung
Laufzeit vom 01.01.2013 bis 30.09.2015
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.052 / IGF-Nr.: 17.750 N
Untersuchung zum reibungsbasierten Schließen des Endloches beim Rührreibschweißen (FSW)
Laufzeit vom 01.04.2013 bis 31.03.2015
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.054 / IGF-Nr.: 18.020 B
Untersuchungen zur Übertragbarkeit der Prozessgrößen beim Diffusionsschweißen in Abhängigkeit von der Bauteilgeometrie und den Erwärmungsbedingungen
Laufzeit vom 01.01.2014 bis 30.09.2016
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
2) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.056 / IGF-Nr.: 00.108 E
Development and evaluation of advanced welding technologies for multi-material design with dissimilar sheet metals InnoJoin
Laufzeit vom 01.01.2014 bis 30.06.2016
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.064 / IGF-Nr.: 18.841 N
Gradierte Oberflächen durch Laserbearbeitung für Rührreibschweißwerkzeuge erhöhter Standzeit (LaserOptRRS)
Laufzeit vom 01.10.2015 bis 30.09.2017
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe
2) Universität Kassel

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.066 / IGF-Nr.: 18.843 B
Strategie zur Skalierung des Rührreibschweißens unter besonderer Berücksichtigung der Werkzeug/ Werkstoff Wechselwirkung - "Friction Stir Scaling"
Laufzeit vom 01.09.2015 bis 31.12.2017
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.068 / IGF-Nr.: 19.036 B
Entwickeln eines Pressschweißverfahrens zum Fügen von Kupfer mit Aluminiumlitzen durch die kontrollierte Bildung eines Eutektikums
Laufzeit vom 01.02.2016 bis 31.07.2018
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
2) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.071 / IGF-Nr.: 19.205 B
Fügen von Aluminium-Stahl-Verbunden durch einseitig konduktive Erwärmung
Laufzeit vom 01.11.2016 bis 31.01.2019
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 05.135 / IGF-Nr.: 85.460 N
Untersuchungen zum MAG-Mehrdrahtschweißen
Laufzeit vom 01.09.1991 bis 31.08.1993
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 05.142 / IGF-Nr.: 83.670 N
Leistungssteigerung beim Auftragschweißen mit Füllbandelektroden
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 05.144 / IGF-Nr.: 82.380 N
Wolfram-Inertgasschweißen mit zwei getrennt zugeführten Schutzgasströmen
Laufzeit vom 01.10.1990 bis 30.09.1992
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 05.145 / IGF-Nr.: 86.170 N
Untersuchung von Drahtvorschubsystemen mit mehreren Antrieben zur Förderung des Schweißdrahtes über lange Wege an mechanisierten und automatisierten Schweißanlagen
Laufzeit vom 01.06.1991 bis 31.05.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 05.148 / IGF-Nr.: 86.150 N
Grundlegende Untersuchungen zum Plasma-Pulver-Auftrag-(PPA)-Schweißen mit oxidkeramischen Pulverlegierungen
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 05.149 / IGF-Nr.: 23.000 Q
Qualitätssicherung von MSG-Schweißprozessen durch rechnergestützte Schweißdatenüberwachung und -protokollierung
Laufzeit vom 01.06.1991 bis 31.05.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 05.151 / IGF-Nr.: 14.000 D
Entwicklung einer objektiven Bewertungsmethode zur Beurteilung und Entwicklung von Schweißstromquellen zum MAG-Schweißen
Laufzeit vom 01.05.1991 bis 31.12.1993
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde Fachgebiet Fügen durch Stoffverbi
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
Vorhaben: DVS-Nr.: 05.152 / IGF-Nr.: 33.600 D
Untersuchungen der Oberfläche von MAG-Drahtelektroden zur Verbesserung von Prozessstabilität und Schweißnahtqualität beim automatisierten Schutzgasschweißen
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 05.153 / IGF-Nr.: 33.500 D
Erarbeitung von Schweißbedingungen für ein produktives und zuverlässiges MAG-Schweißen von hochlegierten Stählen
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 05.154 / IGF-Nr.: 39.800 D
Zusammenstellung von abgesicherten Schweißprozessdaten und mechanisch technologischen Eigenschaftswerten fertigungs-, konstruktions- und reparaturgeschweißter Stahlgussteile
Laufzeit vom 01.08.1991 bis 31.12.1993
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 05.155 / IGF-Nr.: 39.700 D
Prozessmesstechnik zum Lichtbogenschweißen - Entwicklung und Anpassung von zugeschnittener Prozessmesstechnik für die Untersuchung von Lichtbogenschweißprozessen und die Darstellung von mathematischen Zusammenhängen zwischen den Messgrößen und den Schweiß
Laufzeit vom 01.08.1991 bis 31.12.1993
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
2) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv
Vorhaben: DVS-Nr.: 05.156 / IGF-Nr.: 39.500 D
Herstellung hoch beanspruchter Verbundbauteile komplizierter Geometrie durch formgebendes Schweißen mit dem PPA-Verfahren
Laufzeit vom 01.08.1991 bis 31.12.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
Vorhaben: DVS-Nr.: 05.157 / IGF-Nr.: 43.000 D
Plasma-Heißdraht-Auftragschweißen (PHA) mit gas- und aufmischungsempfindlichen Nichtlbasiswerkstoffen (Prof. Koppe, Fachhochschule Anhalt)
Laufzeit vom 01.08.1991 bis 31.12.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 05.158 / IGF-Nr.: 93.070 N
Untersuchung konventioneller MSG-Drahtförderprinzipien mit einem Antrieb hinsichtlich kontinuierlicher Drahtförderung und Erarbeitung eines verbesserten Antriebskonzeptes
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 05.164 / IGF-Nr.: 94.020 B
MAG-Feinblechschweißen mit Massivdrähten und speziellen Fülldrähten vorzugsweisen unter heliumhaltigen Schutzgasgemischen
Laufzeit vom 01.05.1993 bis 31.08.1995
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
Vorhaben: DVS-Nr.: 05.168 / IGF-Nr.: 94.310 B
On-Line-Fehlerüberwachung beim MAG- Dünnblechschweißen durch Fuzzy-Control
Laufzeit vom 01.05.1993 bis 30.06.1995
Beteiligte Institute:
1) Helmut-Schmidt-Universität Universität der Bundeswehr Hamburg
2) Leibniz Universität Hannover Institut für Werkstoffkunde Fachgebiet Fügen durch Stoffverbi
Vorhaben: DVS-Nr.: 05.169 / IGF-Nr.: 97.790 N
MIG-Aluminiumschweißen im Blechdickenbereich von 1 - 8 mm
Laufzeit vom 01.04.1994 bis 31.07.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 05.170 / IGF-Nr.: 94.300 B
Entwicklung auftraggeschweißter Eisenhartstoffbeschichtungen mit metastabiler Eisen-Mangan-Matrix
Laufzeit vom 01.06.1993 bis 31.05.1995
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
Vorhaben: DVS-Nr.: 05.996 / IGF-Nr.: 10.631 N
Qualifizierung von ultraschallgeschweißten Keramik-Metallverbindungen durch Optimierung der Interlayer, Fügeteilgeometrie und Fertigungsparameter
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Materialprüfungsanstalt (MPA) Universität Stuttgart
Vorhaben: DVS-Nr.: 05.999 / IGF-Nr.: 98.100 N
Reibschweißen von oberflächenbehandelten Stahl- und Gußkomponen-ten hoher Oberflächenhärte und geringer Adhäsionsneigung
Laufzeit vom 01.04.1994 bis 31.03.1996
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: I2.022 / IGF-Nr.: 18.966 B
Entwicklung eines Reibgesetzes zur Erfassung des Drehzahleinflusses bei der Reibschweißprozesssimulation
Laufzeit vom 01.01.2016 bis 31.05.2018
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
FA 6 - Strahlverfahren
Vorhaben: DVS-Nr.: / IGF-Nr.: 95.050 B
Ermittlung relevanter Daten zur Realisierung des Parametertransfers beim Elektronenstrahlschweißen
Laufzeit vom 01.07.1993 bis 30.06.1995
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
3) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
4) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik
5) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik
6) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
7) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
8) Laser Zentrum Hannover e.V.
9) BIAS - Bremer Institut für angewandte Strahltechnik GmbH
Vorhaben: DVS-Nr.: 06.004 / IGF-Nr.: 98.030 N
Untersuchungen zur Schweißeignung von Stählen zum Laserstrahlschweißen mit CO2-Hochleistungslasern
Laufzeit vom 01.07.1994 bis 30.09.1997
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 06.006 / IGF-Nr.: 98.040 N
Auftragschweißen von Molybdän-Sinterbändern durch Laserstrahlung
Laufzeit vom 01.07.1994 bis 31.12.1997
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 06.009 / IGF-Nr.: 10.379 N
Untersuchung von Abluftreinigungsverfahren für die Laserstrahlbearbeitung organischer Werkstoffe
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
Vorhaben: DVS-Nr.: 06.010 / IGF-Nr.: 10.382 N
Laser- und Elektronenstrahlschweißen von Werkstoffkombinationen aus Gusswerkstoffen mit Einsatz- und Vergütungsstählen
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 06.012 / IGF-Nr.: 10.380 N
Elektronentrahlschweißen von Aluminium-Druckguss für den industriellen Einsatz und Verfahrensvergleich mit dem Laserstrahlschweißen
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
Vorhaben: DVS-Nr.: 06.014 / IGF-Nr.: 10.728 N
Verfahrens- und Anwendungsuntersuchungen zum Atmosphärenelektronenstrahlschweißen
Laufzeit vom 01.07.1996 bis 30.06.1998
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 06.015 / IGF-Nr.: 10.727 N
Ermittlung der Eigenschaften laser- und elektronenstrahlgeschweißter Magnesium-Druckgussverbindungen
Laufzeit vom 01.07.1996 bis 30.06.1998
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 06.016 / IGF-Nr.: 10.624 N
Zerstörungsfreies Prüfen von laserstrahlgeschweißten Bauteilen
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Fraunhofer-Institut für Zerstörungsfreie Prüfverfahren
Vorhaben: DVS-Nr.: 06.017 / IGF-Nr.: 11.009 N
Erprobung der Doppelstrahltechnik beim Laserstrahlschweißen mit einem Nd:YAG-Festkörperlaser hoher Leistung
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 06.018 / IGF-Nr.: 11.005 N
Untersuchungen zum atmosphärischen Elektronenstrahlschweißen von Bauteilen aus Leichtmetallwerkstoffen auf der Basis von Magnesium
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 06.019 / IGF-Nr.: 11.003 N
Online-Temperaturfeld-Meßsystem zur Qualitätskontrolle beim Laserstrahlschneiden
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
Vorhaben: DVS-Nr.: 06.021 / IGF-Nr.: 11.810 N
Untersuchungen zur Ermittlung von Prozesswechselwirkungen und zur Beeinflussung von Nahteigenschaften beim kombinierten Plasma-Lichtbogen-Laserschweißen
Laufzeit vom 01.11.1998 bis 31.10.2000
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 06.023 / IGF-Nr.: 11.664 N
Strahlschweißen mit hoher Strahlqualität von pulvermetallurgisch hergestellten Werkstoffen
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 06.028 / IGF-Nr.: 12.187 N
Elektronenstrahlschweißen bei der Fertigung von dickwandigen Großrohren aus C-Mn-Stählen
Laufzeit vom 01.12.1999 bis 30.11.2001
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 06.030 / IGF-Nr.: 12.148 N
Einfluss der Bauteilgeometrie und der Legierungselemente auf die Schweißeignung von Stählen zum Laserstrahlschweißen
Laufzeit vom 01.11.1999 bis 31.10.2001
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 06.032 / IGF-Nr.: 12.578 B
Spannungsrisskorrosion an Strahlschweißnähten bei un- und niedriglegierten Baustählen
Laufzeit vom 01.08.2000 bis 31.07.2002
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.033 / IGF-Nr.: 12.580 B
Untersuchungen zum Laserstrahlschweißen mit mobilen, handgeführten oder teilmechanisierten Bearbeitungssystemen
Laufzeit vom 01.08.2000 bis 31.07.2002
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.034 / IGF-Nr.: 12.752 N
Nahtgestaltung und Werkstoffreaktionen beim Elektronen-strahlschweißen von Al-Werkstoffen an Atmosphäre
Laufzeit vom 01.03.2001 bis 28.02.2003
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.037 / IGF-Nr.: 12.740 B
Elekronenstrahlschweißen mit Zusatzwerkstoff unter Anwendung der frei programmierbaren Ablenktechnik
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.038 / IGF-Nr.: 12.643 B
Laserstrahldispergieren von Titanwerkstoffen zur Herstellung boridverstärkter hochveschleißfester und korrosionsbeständiger Oberflächen
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.039 / IGF-Nr.: 12.649 N
Entwicklung flexibel arbeitender Laseroptiken für mittelständische Schweißbetriebe und Laser-Job-Shops zum Fügen verschmutzter Teile
Laufzeit vom 01.10.2000 bis 31.03.2003
Beteiligte Institute:
1) BIAS - Bremer Institut für angewandte Strahltechnik GmbH
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.040 / IGF-Nr.: 12.619 N
Vergleichende Untersuchungen zum Einfluß des Hochleistungs-strahlschweißens auf die metallurgischen Eigenschaften von Aluminium- und Magnesiumlegierungen
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.041 / IGF-Nr.: 13.596 B
Verfahrensentwicklung zum Laserdispergieren von Si-Hartstoffen in Aluminiumlegierungen zum partiellen Verschleißschutz
Laufzeit vom 01.03.2003 bis 28.02.2005
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
2) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.042 / IGF-Nr.: 13.407 N
Untersuchungen zur Nutzung der Synergieeffekte beim Hochleistungs- Laser-Hybridschweißen von dickwandigen Rohrkörpern aus C-Mn-Stählen
Laufzeit vom 01.01.2003 bis 31.12.2004
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.044 / IGF-Nr.: 13.283 B
Qualifizierung von Elektronenstrahlverfahren zur Verbesserung der Verschleiß- und Korrosionsbeständigkeit von Leichtmetallwerkstoffen (Magnesiumlegierungen)
Laufzeit vom 01.05.2002 bis 30.04.2004
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.046 / IGF-Nr.: 13.674 N
Qualifizierung des Nd: YAG- und CO2-Laser-Plasma-Pulver-Hybridschweißens
Laufzeit vom 01.06.2003 bis 30.09.2005
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.047 / IGF-Nr.: 14.433 N
Qualifizierung zerstörungsfreier Prüfverfahren hinsichtlich ihrer Eignung zur Charakterisierung laserstrahlgeschweißter Überlappverbindungen an Stahl
Laufzeit vom 01.07.2005 bis 30.06.2007
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.049 / IGF-Nr.: 13.600 N
Hochfrequentes Strahlpendeln zur Erhöhung der Prozessstabilität beim Laserstrahlschweißen mit Hoher Schmelzbaddynamik
Laufzeit vom 01.03.2004 bis 31.05.2006
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.050 / IGF-Nr.: 13.719 N
Entwicklung eines Meßverfahrens für die Diagnostik des Elektronenstrahles an Atmosphäre
Laufzeit vom 01.06.2003 bis 31.05.2005
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.051 / IGF-Nr.: 13.953 N
Schweissnahtqualität und Anwendungspotential beim Remote-Welding mit hoher Leistung
Laufzeit vom 01.08.2004 bis 31.07.2006
Beteiligte Institute:
1) BIAS - Bremer Institut für angewandte Strahltechnik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.054 / IGF-Nr.: 15.297 N
Nahtschweißen mit gepulsten Nd:YAG-Lasern und Anpassung der Nahteigenschaften an mit Dauerstrichlasern geschweißte Nähte
Laufzeit vom 01.08.2007 bis 31.07.2009
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.055 / IGF-Nr.: 14.815 N
Untersuchungen zum strahlschweißtechnischen Fügen von artfremden metallischen Werkstoffkombinationen
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.059 / IGF-Nr.: 15.373 B
Wärmearmes Laserstrahllöten von verzinkten Stählen mittels niedrigschmelzender Lotwerkstoffe
Laufzeit vom 01.10.2007 bis 30.09.2009
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.061 / IGF-Nr.: 14.959 N
Gestaltung und Kontrolle des Nahtdurchhanges beim Strahlschweißen
Laufzeit vom 01.01.2007 bis 31.12.2008
Beteiligte Institute:
1) Universität Stuttgart Institut für Strahlwerkzeuge

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.062 / IGF-Nr.: 14.960 N
Einsatz von Wirbelstromtechnik zur Nahtverfolgung beim Laserstrahlschweißen von Nullspaltfugen
Laufzeit vom 01.01.2007 bis 31.12.2008
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.063 / IGF-Nr.: 15.744 N
Einfluss des Umformgrades (Kaltverfestigung) auf die Schweiß- und Löteignung von beschichteten Feinblechen mit Rp >= 800 N/mm²
Laufzeit vom 01.11.2008 bis 31.10.2010
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.064 / IGF-Nr.: 15.560 N
Qualifizierung und Optimierung des Fügens mit dem Elektronenstrahl in Zwangspositionen
Laufzeit vom 01.08.2008 bis 31.10.2010
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.065 / IGF-Nr.: 15.536 N
Mikro-Laser-MSG Hybridschweißen von Dünnblechen und Metallfolien
Laufzeit vom 01.03.2008 bis 31.05.2010
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.067 / IGF-Nr.: 15.917 N
Laser-MSG-Hybridschweißen von dickwandigen Präzisionsrohren
Laufzeit vom 01.12.2008 bis 28.02.2011
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.068 / IGF-Nr.: 16.260 N
Erweiterung der Anwendungsgrenzen beim Fügen mittels pulsmodulierbarer Strahlquellen durch den synergetischen Einsatz eines zeitlich vorgelagerten Plasmalichtbogens
Laufzeit vom 01.11.2009 bis 31.10.2013
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht
2) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.069 / IGF-Nr.: 16.139 N
Anwendung der Mehrstrahltechnik zur Reduzierung der Eigenspannungen bei EB- und LB-geschweißten Bauteilen
Laufzeit vom 01.07.2009 bis 30.06.2011
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.070 / IGF-Nr.: 16.362 B
Verbesserung der Prozessstabilität beim Laserpunktschweißen von Kupfer und Cu-Mischverbindungen durch den Einsatz prozessinterner dynamischer Leistungsregelungen pulsmodulierbarer Laserstrahlquellen
Laufzeit vom 01.02.2010 bis 30.04.2012
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.071 / IGF-Nr.: 16.517 N
Einsatz der Mehrfokustechnik beim Laser- und Elektronenstrahlschweißen zur Beeinflussung der Schmelzbaddynamik am Beispiel ausscheidungshärtender Nickelbasis-Superlegierungen
Laufzeit vom 01.06.2010 bis 31.05.2012
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) BIAS - Bremer Institut für angewandte Strahltechnik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.072 / IGF-Nr.: 16.671 N
Laser-MSG Hybridschweißen unter Zuhilfenahme niederenergetischer Lichtbogenschweißverfahren
Laufzeit vom 01.08.2010 bis 31.07.2012
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.075 / IGF-Nr.: 17.148 N
Laserstrahlschweißen von Mischverbindungen aus ferritischen und austenitischen rostfreien Edelstählen für Anwendungen im Dünnblechbereich
Laufzeit vom 01.05.2011 bis 30.04.2013
Beteiligte Institute:
1) Bayerisches Laserzentrum GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.076 / IGF-Nr.: 17.264 N
Induzierte Wärmefelder zur Verminderung der Heißrissneigung beim Laserstrahlschweißen von Aluminium (InduWäLs)
Laufzeit vom 01.09.2011 bis 31.07.2014
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.078 / IGF-Nr.: 17.265 N
Verbesserung der Nahtqualität von lasergeschweißten Verbindungen aus Aluminiumlegierungen mittels oszillierender Magnetfelder
Laufzeit vom 01.09.2011 bis 31.08.2013
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.079 / IGF-Nr.: 17.350 N
Reduzierung von Imperfektionen beim Elektronenstrahlschweißen mit Zusatzwerkstoff von Dickblechen aus Aluminiumlegierungen
Laufzeit vom 01.01.2012 bis 31.12.2013
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.080 / IGF-Nr.: 17.404 B
Laser-Mehrlagen-Engspaltschweißen zum verzugsarmen und heißrissfreien Fügen von Aluminium-Legierungen im Dickblechbereich LASER-MESSAGE
Laufzeit vom 01.02.2012 bis 31.01.2014
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.081 / IGF-Nr.: 17.487 B
Prozessstrategie zur Stabilisierung des gepulsten Laserstrahlschweißens und zur Verbesserung der Nahtgüte beim Schweißen von Aluminiumwerkstoffen mittels Kombination eines Diodenlasers mit einem gepulsten Festkörperlaser
Laufzeit vom 01.10.2012 bis 30.09.2014
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.082 / IGF-Nr.: 17.558 N
Wärmearmes Schweißen von Aluminium mit hoher Spaltüberbrückbarkeit durch Strahlmodulation beim Schweißen mit hoch fokussierenden Festkörperlasern mit Zusatzwerkstoff
Laufzeit vom 01.11.2012 bis 31.10.2014
Beteiligte Institute:
1) BIAS - Bremer Institut für angewandte Strahltechnik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.083 / IGF-Nr.: 17.625 N
Zylindrische Polarisation für spritzerfreies Laserstrahlschweißen
Laufzeit vom 01.12.2012 bis 30.11.2014
Beteiligte Institute:
1) Universität Stuttgart Institut für Strahlwerkzeuge

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.084 / IGF-Nr.: 17.560 N
Verbesserung der Schweißnahtqualität beim Laserstrahlschweißen mit Festkörperlasern von Stählen für den Getriebebau durch den Einsatz von reduziertem Umgebungsdruck
Laufzeit vom 01.11.2012 bis 31.10.2014
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.086 / IGF-Nr.: 17.968 N
Konzeption und Erprobung eines mobilen Vakuumsystems zur Optimierung der Wirtschaftlichkeit des Laserstrahl- und des Elektronenstrahlschweißens (MoVak)
Laufzeit vom 01.12.2013 bis 31.12.2016
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.087 / IGF-Nr.: 18.087 N
Untersuchungen zum Einfluss von Härte- und Gefügezustand strahlgeschweißter Verbindungen an Stählen auf deren Verformungs- und Tragverhalten
Laufzeit vom 01.03.2014 bis 31.12.2016
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.089 / IGF-Nr.: 18.156 N
Reduzierung der Porenbildung beim Laserstrahlschweißen von Aluminium-Druckgusslegierungen durch reduzierten Umgebungsdruck und/oder Doppelfokustechnik (ReduPore)
Laufzeit vom 01.04.2014 bis 31.10.2016
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.090 / IGF-Nr.: 18.510 N
Verbesserung der Mikrostruktur von laserstrahlgeschweißten, ultrahochfesten Stählen durch gezielte Wärmeführung
Laufzeit vom 01.12.2014 bis 31.05.2017
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.091 / IGF-Nr.: 18.334 B
Prozessstrategie zum Reparieren von Nickelbasisbauteilen mittels Laserstrahl
Laufzeit vom 01.09.2014 bis 31.08.2016
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.093 / IGF-Nr.: 18.386 N
Steigerung der Prozesseffizienz beim Laserstrahllöten
Laufzeit vom 01.04.2015 bis 31.03.2017
Beteiligte Institute:
1) BIAS - Bremer Institut für angewandte Strahltechnik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.094 / IGF-Nr.: 18.335 N
Oberflächenkonditionierung von Kupferwerkstoffen zur Stabilisierung des Lasermikroschweißens
Laufzeit vom 01.09.2014 bis 31.08.2016
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.096 / IGF-Nr.: 18.707 N
Laserstrahlschweißen von Kupfer und Kupferlegierungen größer 3 mm Dicke unter reduziertem Arbeitsdruck bis hin zum Feinvakuum
Laufzeit vom 01.04.2015 bis 30.09.2017
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.102 / IGF-Nr.: 18.840 N
Einfluss der Schwankungen von Kathodeneigenschaften auf die Strahlqualität und das Schweißergebnis beim Elektronenstrahlschweißen
Laufzeit vom 01.10.2015 bis 31.03.2018
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
2) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.103 / IGF-Nr.: 00.145 E
Two Step Laser Coating for 3D Surfaces and Large Areas
Laufzeit vom 01.07.2015 bis 30.06.2017
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Lasertechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.107 / IGF-Nr.: 18.582 B
Spritzerarmes Laserstrahlschweißen bei hohen Geschwindigkeiten unter Einsatz angepasster Intensitätsverteilungen
Laufzeit vom 01.07.2016 bis 31.01.2019
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik
2) Technische Universität Ilmenau Fachgebiet Technische Optik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.900 / IGF-Nr.: 18.149 B
RemoStAad - Steigerung von Prozessstabilität und Schweißnahtqualität beim Remote-Laserschweißen durch gezielte Strömungsführung mittels Anlagenadaption
Laufzeit vom 01.04.2014 bis 30.09.2016
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 06.901 / IGF-Nr.: 16.600 N
Prozesssicheres und leistungsstarkes Fügen von hochfesten Feinkornbaustählen durch ein Hybridschweißverfahren mit integrierter Vorwärmung (DOVOR)
Laufzeit vom 01.02.2011 bis 31.07.2013
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Leibniz Universität Hannover Institut für Stahlbau

[weitere Informationen zum Projekt]
FA 7 - Löten
Vorhaben: DVS-Nr.: 07.000 / IGF-Nr.: 48.000 Z
Verarbeitbarkeit und Zuverlässigkeit der bleifreien Lote SnAg3,9Cu0,6 und SnCu0,7 für das Reflow-, Wellen- und Reparaturlöten
Laufzeit vom 01.05.2001 bis 30.04.2003
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
3) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.001 / IGF-Nr.: 49.000 Z
Oberflächentechnik für die Bearbeitung bleifreier Lote in Lötmaschinen
Laufzeit vom 01.05.2001 bis 30.04.2003
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
3) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.002 / IGF-Nr.: 00.132 Z
Volumeneffekte und technische Zuverlässigkeit von bleifreien Lötstellen
Laufzeit vom 01.11.2003 bis 30.04.2006
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.003 / IGF-Nr.: 00.131 Z
Oberflächeneffekte von Komponenten zum bleifreien Löten
Laufzeit vom 01.11.2003 bis 31.10.2005
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.004 / IGF-Nr.: 14.975 B
Online-Lotbaddiagnostik zur Qualitätssicherung beim Wellen- und Selektivlöten
Laufzeit vom 01.09.2006 bis 31.08.2008
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
3) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
4) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.006 / IGF-Nr.: 15.113 N
Systematische Untersuchung der Fügeverbundeigenschaften von Lötungen mit Ag-, Cu- und Ni-Basisloten mit anwendungsrelevanten Prüfverfahren
Laufzeit vom 01.07.2007 bis 30.06.2009
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.007 / IGF-Nr.: 10.097 B
Versetzte Weichlötdepots
Laufzeit vom 01.11.1994 bis 31.10.1996
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
Vorhaben: DVS-Nr.: 07.010 / IGF-Nr.: 10.629 N
Untersuchungen zum isothermen Löten von austenitformgehärteten Stählen mit Verbundloten auf Kupferbasis
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.011 / IGF-Nr.: 10.618 N
Herstellung und Eigenschaftsbestimmung dünner Auftraglötschichten
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.013 / IGF-Nr.: 10.627 N
Flussmittelfreies Löten nicht artgleicher metallischer Werkstoffe
Laufzeit vom 01.03.1996 bis 31.07.1997
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.016 / IGF-Nr.: 11.254 B
Anwendung des Laserstrahllötens zum Fügen von Keramiken bzw. Gläsern mittels anorganisch-nichtmetallischen Zwischenschichten
Laufzeit vom 01.11.1997 bis 31.10.1999
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
Vorhaben: DVS-Nr.: 07.018 / IGF-Nr.: 10.976 N
Entwicklung einer Technologie zum flussmittelfreien Löten verzinkten Stahls
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.019 / IGF-Nr.: 11.465 N
Qualitätssicherung und –Kontrolle im Reflowlötprozess
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
Vorhaben: DVS-Nr.: 07.023 / IGF-Nr.: 11.384 N
Prozessfähigkeit und Zuverlässigkeit höherschmelzender, binärer Lotwerkstoffe bei Verwendung handelsüblicher Bauelemente und angewandter Verfahren
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau
Vorhaben: DVS-Nr.: 07.024 / IGF-Nr.: 11.469 N
Entwicklung einer Schutzgasinduktionslöttechnik zur Herstellung von Keramik-Metall-Aktivlötverbindungen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.025 / IGF-Nr.: 11.543 B
Aktivlöten von Quarzglas und Diamant
Laufzeit vom 01.05.1998 bis 30.04.2000
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
Vorhaben: DVS-Nr.: 07.026 / IGF-Nr.: 11.878 N
Evaluierung des Einsatzpotentials von Nickel-Hafnium-Chrom-Lotlegierungen zum Löten von Superlegierungen und rostfreien Edelstählen
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.027 / IGF-Nr.: 12.077 B
Alternatives Löten von Mikrobausteinen
Laufzeit vom 01.05.1999 bis 30.04.2001
Beteiligte Institute:
1) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
Vorhaben: DVS-Nr.: 07.029 / IGF-Nr.: 11.812 N
Entwicklung neuer Schutzgasaktivatoren für das flussmittelfreie Löten von Aluminiumlegierungen
Laufzeit vom 01.11.1998 bis 31.10.2000
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.030 / IGF-Nr.: 12.493 N
Entwicklung des Hartlötens mit partieller Erwärmung zum Fügen dünnwandiger Titanlegierungen
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.031 / IGF-Nr.: 12.579 B
Einfluß der Korrosionsbeständigkeit von Metall-Keramik-Verbindungen auf deren Langzeitverhalten
Laufzeit vom 01.08.2000 bis 31.07.2002
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.032 / IGF-Nr.: 12.492 N
Pulvermetallurgisch hergestellte, niedrigschmelzende Al-Basislote zum Löten von hochlegierten Al-Legierungen
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.033 / IGF-Nr.: 12.640 N
Einfluß der Mikrometallurgie auf Prozeßfähigkeit und Zuverlässigkeit mikrotechnischer Lötverbindungen
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.034 / IGF-Nr.: 12.843 N
Werkstoffauswahl und Prozessgestaltung zur Herstellung von porenarmer Weichlötverbindungen
Laufzeit vom 01.04.2001 bis 30.09.2003
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
3) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.035 / IGF-Nr.: 12.675 N
Hartlöten von hartmetallbestückten Bauteilen und Werkzeugen
Laufzeit vom 01.11.2000 bis 31.10.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.037 / IGF-Nr.: 12.644 B
Laserlöten von Silizium/Glas mittels Glaslot zur Kapselung von Mikrosensoren auf Waferebene
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
2) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.038 / IGF-Nr.: 13.360 N
Flussmittelfreies Flammlöten von Aluminiumlegierungen durch Ultraschallunterstützung
Laufzeit vom 01.08.2002 bis 31.07.2004
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.039 / IGF-Nr.: 13.097 B
Entwicklung neuer Lote für das Hochtemperaturlöten mechanisch hochbeanspruchter Stahlkomponenten
Laufzeit vom 01.11.2001 bis 31.10.2003
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.040 / IGF-Nr.: 13.456 N
Qualifizierung der Plasmalöttechnik zur Herstellung von Mischverbunden aus Magnesium- und Aluminiumlegierungen
Laufzeit vom 01.01.2003 bis 31.12.2004
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.041 / IGF-Nr.: 13.485 N
Qualifizierung des Reflowlötprozesses zur Verarbeitung von THT-Bauteilen
Laufzeit vom 01.03.2003 bis 28.02.2005
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.042 / IGF-Nr.: 13.598 N
Weiterentwicklung des Hochtemperaturlötens mit Lederburitloten
Laufzeit vom 01.03.2003 bis 28.02.2005
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.044 / IGF-Nr.: 14.568 N
Beanspruchungsgerechter Verschleißschutz für Bauteile aus Titanwerkstoffen in tribologischen Systemen
Laufzeit vom 01.09.2005 bis 31.08.2007
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.045 / IGF-Nr.: 13.788 B
Entwicklung eines Controlled Atmosphere Brazing (CAB) Verfahrens zum Fügen von Aluminiumguss- und Aluminiumknetlegierungen
Laufzeit vom 01.08.2003 bis 31.07.2005
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.046 / IGF-Nr.: 14.439 B
Modifizierte Ni-Basis-Standardlote zum Hochtemperaturlöen von hochlegierten, stark korrosiv beanspruchten Stählen
Laufzeit vom 01.07.2005 bis 30.06.2007
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.048 / IGF-Nr.: 13.986 N
Entwicklung galvanisch hergestellter Hochtemperaturlot-Folien, -Drähte und -Beschichtungen aus Nickel-Chrom-haltigen Legierungen
Laufzeit vom 01.02.2005 bis 31.01.2007
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.052 / IGF-Nr.: 14.814 B
Entwicklung von lötgerechten Konstruktions- und Verfahrensstrategien/ -empfehlungen zum Fügen von temperierbaren Werkzeugen mittels Hochtemperaturlötens
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.054 / IGF-Nr.: 15.374 N
Untersuchung zu den thermischen und prozesstechnischen Eigenschaften von Flussmitteln für bleifreie Lotlegierungen auf hochzuverlässigen Baugruppen
Laufzeit vom 01.10.2007 bis 31.03.2009
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.056 / IGF-Nr.: 15.405 B
Entwicklung von Eisenbasisloten zum Hochtemperaturlöten von trinkwasserkontaktierten Werkstoffen
Laufzeit vom 01.11.2007 bis 31.10.2009
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.057 / IGF-Nr.: 15.535 N
Lötwärmebeständigkeit und Zuverlässigkeit neuer Konstruktionen im manuellen Reparaturprozess bleifreier elektronischer Baugruppen
Laufzeit vom 01.02.2008 bis 31.07.2010
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.058 / IGF-Nr.: 15.444 N
Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-Zn
Laufzeit vom 01.12.2007 bis 30.11.2009
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.059 / IGF-Nr.: 15.711 N
Entwicklung eines neuen Prüfverfahrens zur Klassifizierung von Flussmitteln
Laufzeit vom 01.07.2008 bis 30.09.2009
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.060 / IGF-Nr.: 16.036 N
Bor- und phosphorfreie Nickelbasislote für das Löten im Schutzgasdurchlaufofen
Laufzeit vom 01.04.2009 bis 31.03.2011
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.061 / IGF-Nr.: 16.194 B
Entwicklung niedrigschmelzender Lote für hochfeste Aluminiumlegierungen
Laufzeit vom 01.09.2009 bis 31.08.2011
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.062 / IGF-Nr.: 16.558 N
Systematische Untersuchung der Eigenschaften gelöteter Fügeverbunde mit anwendungsrelevanten Prüfverfahren II
Laufzeit vom 01.05.2010 bis 30.04.2012
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.064 / IGF-Nr.: 16.871 N
Industrielle Nutzung des Reactive Air Brazings zum Fügen von leckdichten Keramik-Keramik- und Keramik-Metall-Verbunden
Laufzeit vom 01.01.2011 bis 31.12.2012
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.068 / IGF-Nr.: 16.941 N
Ermittlung von Versagenskriterien mechanisch-korrosiv belasteter, hartgelöteter Edelstahlblechverbindungen unter Berücksichtigung der Nickellotmetallurgie und der Fertigungsbedingungen
Laufzeit vom 01.07.2012 bis 30.06.2014
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.069 / IGF-Nr.: 17.622 B
Entwicklung von Co-Basis-Loten zum Hochtemperaturlöten hochfester, thermisch stark belasteter Bauteile aus Co-Basislegierungen
Laufzeit vom 01.12.2012 bis 31.05.2015
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.070 / IGF-Nr.: 17.748 B
Korrelation zwischen der Oberflächenhistorie, den Prozessbedingungen und der Löteignung von Aluminiumwerkstoffen
Laufzeit vom 01.07.2013 bis 30.06.2015
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.071 / IGF-Nr.: 17.776 N
Verbesserung der Gebrauchseigenschaften hochtemperaturgelöteter Verbindungen durch thermodynamisch ausgelegte Temperatur-/Zeitzyklen
Laufzeit vom 01.01.2014 bis 31.03.2017
Beteiligte Institute:
1) Hochschule Niederrhein Fachbereich Maschinenbau und Verfahrenstechnik
2) Technische Universität Berlin Institut für Mechanik - Fakultät V Fachg. f. Kontinuumsmech.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.073 / IGF-Nr.: 18.387 N
Systematische Untersuchung der Einflüsse von Oberflächenzuständen auf gelötete Fügeverbunde mit anwendungsrelevanten Prüfverfahren
Laufzeit vom 01.11.2014 bis 31.07.2017
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.074 / IGF-Nr.: 17.884 N
Entwicklung von Prozessen zum flussmittelfreien Schutzgas-Hartlöten zwischen 650°C und 850°C durch Einsatz silandotierter Prozessgase
Laufzeit vom 01.10.2013 bis 30.09.2015
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.075 / IGF-Nr.: 17.907 N
Vermeidung binderbedingter Fehlstellen durch prozesssichere Verarbeitung von Lotpasten bei flächigen Bauteillötungen
Laufzeit vom 01.11.2014 bis 31.08.2017
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.076 / IGF-Nr.: 18.284 B
Untersuchung der Gefüge-Eigenschafts-Beziehungen von Eisenbasisloten
Laufzeit vom 01.07.2014 bis 30.06.2017
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.077 / IGF-Nr.: 18.422 B
Entwicklung eines Lötverfahrens für die Fertigung von wassergekühlten Bipolplatten aus chrombeschichteten Metallfolien für PEM-Brennstoffzellen
Laufzeit vom 01.11.2014 bis 31.10.2016
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
2) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.078 / IGF-Nr.: 18.507 B
Verringerung der Schwermetallionenmigration kupfergelöteter Plattenwärmeübertrager (PWÜ) für Trinkwasseranwendungen
Laufzeit vom 01.12.2014 bis 31.05.2017
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.080 / IGF-Nr.: 18.469 N
Qualifizierung der elektrischen Widerstandsmessungen zur zerstörungsfreien Prüfung von Hartlötverbindungen - LöWe
Laufzeit vom 01.01.2015 bis 31.12.2016
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.081 / IGF-Nr.: 18.706 N
Entwicklung von kupfer- und nickelbasierten Lötsystemen mit niedrigen Verarbeitungs- aber hohen Wiederaufschmelztemperaturen
Laufzeit vom 01.04.2015 bis 31.03.2017
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.082 / IGF-Nr.: 18.705 B
Entwicklung eines standardisierten Messverfahrens zur in situ Bestimmung des Benetzungs- und Fließverhaltens von Hartloten
Laufzeit vom 01.04.2015 bis 31.03.2017
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.084 / IGF-Nr.: 19.056 B
Untersuchungen zum Einfluss von Stickstoff in der Lötatmosphäre auf die Lebensdauerfestigkeit Ni-Basis-gelöteter Cr-Ni-Stahl-Verbindungen unter korrosiver Belastung
Laufzeit vom 01.04.2016 bis 30.09.2018
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik
2) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.086 / IGF-Nr.: 19.242 N
Herstellung und Applikation thermoplastumhüllter Lotpartikel für die löttechnische Fertigung mit pulverförmigen Hartloten
Laufzeit vom 01.02.2017 bis 31.01.2019
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 07.149 / IGF-Nr.: 84.350 N
Untersuchungen zum Löten von Massenstählen
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.150 / IGF-Nr.: 83.740 N
Technologische Eigenschaften von Breitspaltlötverbindungen an Rohrleitungen
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.151 / IGF-Nr.: 86.310 N
Technologische Eigenschaften von Titanlötverbindungen
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.154 / IGF-Nr.: 86.280 N
Entwicklung eines rechnergestützten Systems zur Optimierung der Fertigung beim Infrarot-Reflow-Löten
Laufzeit vom 01.06.1991 bis 31.05.1993
Beteiligte Institute:
1) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau
Vorhaben: DVS-Nr.: 07.155 / IGF-Nr.: 86.300 N
Untersuchungen zum Korrosionsverhalten von hochtemperaturgelöteten Titanwerkstoffen
Laufzeit vom 01.08.1991 bis 31.07.1993
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.156 / IGF-Nr.: 50.000 D
Stoffschlüssige Fügen von porösen Sintermetallen
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.157 / IGF-Nr.: 14.600 D
Untersuchungen zum flussmittelfreien und schutzgaslosen Hart- und Hochtemperaturlöten
Laufzeit vom 01.05.1991 bis 30.04.1993
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
2) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.158 / IGF-Nr.: 14.500 D
Fügen von ALN mit keramischen Folien
Laufzeit vom 01.05.1991 bis 30.04.1993
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
2) Technische Universität Dortmund Lehrstuhl für Qualitätswesen
Vorhaben: DVS-Nr.: 07.161 / IGF-Nr.: 93.230 N
Beratungs- und Informationssystem zum Hochtemperaturlöten mit Nickelbasislsoten
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.162 / IGF-Nr.: 95.980 N
Flussmittelfreies Löten von Hartmetallen für hohe Einsatztemperaturen
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 07.163 / IGF-Nr.: 95.930 N
Induktives Auftraglöten von Verschleißschutzschichten im kontinuierlichen
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
Vorhaben: DVS-Nr.: 07.165 / IGF-Nr.: 96.260 N
Qualitätssteigerung mikroelektronischer Schaltverbindungen durch Laserlöten mit RS-Weichloten
Laufzeit vom 01.12.1993 bis 30.11.1995
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht
Vorhaben: DVS-Nr.: 07.901 / IGF-Nr.: 00.376 Z
Lotdrähte für das Laserstrahl- und Lichtbogenlöten von Aluminium - SprühLöWe
Laufzeit vom 01.01.2011 bis 30.06.2013
Beteiligte Institute:
1) BIAS - Bremer Institut für angewandte Strahltechnik GmbH
2) IWT Stiftung Institut für Werkstofftechnik
Vorhaben: DVS-Nr.: 07.998 / IGF-Nr.: 10.010 B
Bewerten von Technologien der örtlichen Belotung von Aluminiumbauteilen mit extremem Längen-Breiten-Verhältnis durch Lotwerkstoffe für das flussmittelfreie Hartlöten
Laufzeit vom 01.09.1994 bis 31.08.1996
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
2) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
Vorhaben: DVS-Nr.: 07.999 / IGF-Nr.: 96.520 B
Versagensverhalten und dynamische Festigkeitseigenschaften von Engspaltlötverbindungen
Laufzeit vom 01.11.1993 bis 31.10.1995
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 09.051 / IGF-Nr.: 16.195 N
Berechnungsmethoden und Auslegungskriterien für die betriebsfeste Bemessung von gelöteten Verbindungen aus Stahlwerkstoffen sowie Mischverbindungen unter Berücksichtigung neuartiger Prozessstrategien
Laufzeit vom 01.09.2009 bis 31.12.2012
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
3) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest

[weitere Informationen zum Projekt]
FA 8 - Klebtechnik
Vorhaben: DVS-Nr.: 08.001 / IGF-Nr.: 00.235 Z
Neue konstruktive Möglichkeiten im Betonbau durch Kleben von Bauteilen aus Ultra-Hochfestem Beton
Laufzeit vom 01.01.2007 bis 30.06.2009
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik
3) Universität Kassel Fachbereich Bauingenieurwesen Fachgebiet Werkstoffe des Bauwesens

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.003 / IGF-Nr.: 98.070 N
Untersuchungen zur Wärmeleitfähigkeit und zum Festigkeits- und Alterungsverhalten von Klebverbindungen mit und ohne Füllstoffzusatz im Klebstoff
Laufzeit vom 01.07.1994 bis 30.06.1996
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 08.004 / IGF-Nr.: 98.020 N
Qualitätsrelevante Parameter beim Schweißen von gefüllten und verstärkten Systemen mittels
Laufzeit vom 01.05.1994 bis 30.04.1996
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik
Vorhaben: DVS-Nr.: 08.006 / IGF-Nr.: 10.386 N
Untersuchungen zur Ausbildung von Polymerstrukturen bei Kunststoffklebverbindungen und zu den daraus resultierenden Verbindungseigenschaften bei Kurz- und Langzeitbeanspruchung
Laufzeit vom 01.10.1995 bis 30.09.1997
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 08.007 / IGF-Nr.: 10.383 N
Untersuchungen zur Optimierung des Klebstoffauftrags und Entwicklung eines neuen Steuerungskonzeptes für geschwindigkeitsgeregelte Auftragsdüsen
Laufzeit vom 01.09.1995 bis 31.08.1997
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 08.009 / IGF-Nr.: 10.729 N
Entwicklung eines Prüfverfahrens zur Ermittlung thermischer und reaktionsbedingter Volumenänderungen polymerer Klebstoffe und Gießharze
Laufzeit vom 01.07.1996 bis 30.06.1998
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 08.010 / IGF-Nr.: 11.006 N
Analyse und Identifizierung gas- und aerosolförmiger Emissionen bei der Verarbeitung und Polyurethan-Klebstoffen
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
Vorhaben: DVS-Nr.: 08.011 / IGF-Nr.: 10.691 N
Untersuchungen zur Schweißbarkeit von Fügeteilen aus ungefülltem und gefülltem/verstärktem Polyamid mittels Heizelement
Laufzeit vom 01.05.1996 bis 30.04.1998
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik
Vorhaben: DVS-Nr.: 08.012 / IGF-Nr.: 11.372 N
Untersuchung prozessübergreifender Qualitätssicherungskonzepte beim Ultraschallschweißen unter Anwendung statistischer Methoden
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen
Vorhaben: DVS-Nr.: 08.013 / IGF-Nr.: 10.975 N
Weiterentwicklung des Zugscherversuchs nach DIN 54451 zur Ermittlung der Tau-Gamma-Funktion von Klebschichten in einer einfach überlappten Klebung
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik
Vorhaben: DVS-Nr.: 08.014 / IGF-Nr.: 11.382 N
Biaxiales Vibrationsschweißen von Polymerwerkstoffen: Prozess-Struktur-Eigenschaften
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Friedrich-Alexander-Universität Erlangen-Nürnberg Lehrstuhl für Kunststofftechnik
Vorhaben: DVS-Nr.: 08.016 / IGF-Nr.: 11.662 B
Vergleichende Untersuchungen zum Einsatz anorganisch-nichtmetallischer Zwischenschichten für hochtemperaturbeständige Werkstoffverbunde
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
Vorhaben: DVS-Nr.: 08.017 / IGF-Nr.: 11.467 N
Einfluss des Heizelementschweißprozesses auf die Spannungsrissbildung an Formteilen aus amorphen Thermoplasen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik
Vorhaben: DVS-Nr.: 08.020 / IGF-Nr.: 11.933 N
Einfluss fertigungsbedingter Imperfektionen auf die mechanischen Verbindungseigenschaften von 1K-PUR-Klebungen im Nutzfahrzeugbau
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik
Vorhaben: DVS-Nr.: 08.021 / IGF-Nr.: 11.811 N
Tiefenwirksame und schnelle laserstrahlungsinduzierte Aushärtung von Kunststoff-Klebeverbindungen
Laufzeit vom 01.11.1998 bis 31.10.2000
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
Vorhaben: DVS-Nr.: 08.022 / IGF-Nr.: 12.844 N
Zerstörungsfreie Detektion von Klebverbindungsfehlern mit Ultraschall und Untersuchungen der Auswirkungen dieser Fehler auf die mechanische Beanspruchbarkeit der Verbindung
Laufzeit vom 01.04.2001 bis 30.09.2003
Beteiligte Institute:
1) Fraunhofer-Institut für Zerstörungsfreie Prüfverfahren
2) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.025 / IGF-Nr.: 12.677 N
Untersuchung zum mechanischen Langzeitverhalten von Klebverbindungen unter hygrothermischen Bedingungen mit Berücksichtigung der Zeitraffung
Laufzeit vom 01.11.2000 bis 31.10.2003
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.029 / IGF-Nr.: 13.249 N
Zerstörungsfreie Prüfung von Klebverbindungen mittels der ultraschallangeregten Thermografie
Laufzeit vom 01.04.2002 bis 31.03.2004
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.030 / IGF-Nr.: 13.336 N
Praxisgerechte Untersuchung von Emissionen bei der Verarbeitung und der Verwendung von Polyurethanklebstoffen
Laufzeit vom 01.06.2002 bis 31.05.2004
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.031 / IGF-Nr.: 13.455 N
Prozeßsicheres Kleben von Rundsteckverbindungen aus metallischen Werkstoffen unter rauhen Fertigungsbedingungen
Laufzeit vom 01.03.2003 bis 28.02.2005
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.038 / IGF-Nr.: 13.952 N
Untersuchungen zum Crashverhalten kalthärtender Klebstoffsysteme in Aluminiumverbindungen
Laufzeit vom 01.10.2004 bis 30.09.2006
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.040 / IGF-Nr.: 14.840 N
Strukturelle FVK-Metall-Klebverbindung für Windenergieanlagen
Laufzeit vom 01.07.2006 bis 30.06.2009
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.042 / IGF-Nr.: 14.430 N
Fixierung von lackierten Bauteilen während der Klebstoffaushärtung
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.043 / IGF-Nr.: 14.817 N
Plasmagestützte Abscheidung von Haftvermittlerschichten bei Atmosphärendruck
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.044 / IGF-Nr.: 14.434 N
Einsatz und Optimierung von Haftklebstoffsystemen zur Verbesserung der Prozesssicherheit und der Verbindungseigenschaften beim Laserstrahlschweißen von Überlappnähten
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.045 / IGF-Nr.: 14.929 N
Einfluss der Klebstoffverarbeitung auf das Betriebsverhalten von Dosieranlagen und die mechanischen Eigenschaften von Klebverbindungen
Laufzeit vom 01.01.2007 bis 30.06.2009
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.047 / IGF-Nr.: 15.636 N
Wirksamkeit von Verfahren zur Entfernung von Trennstoffen auf Al-Druckguss-Bauteilen
Laufzeit vom 01.08.2008 bis 31.07.2010
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.048 / IGF-Nr.: 15.443 N
Kleben auf Kunststoffen mit Rückständen aus Formtrennmittel
Laufzeit vom 01.09.2008 bis 31.08.2010
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.049 / IGF-Nr.: 15.595 N
Eigenschaftsprofil schnell gehärteter Klebungverbindungen unter zyklischer Belastung
Laufzeit vom 01.06.2008 bis 31.05.2010
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.050 / IGF-Nr.: 16.031 B
Klebtechnisches Verbinden von Hartstoffschneiden mit Schneideinsatzträgern für Hochleistungswerkzeuge
Laufzeit vom 01.04.2009 bis 31.03.2011
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
2) Technische Universität Kaiserslautern FB Maschinenbau u. Verfahrenstechnik AG Werkstoff- u

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.051 / IGF-Nr.: 16.030 N
Einsatz rationeller parzieller Reinigungsverfahren zur Verbesserung der Raumtemperatur-Klebbarkeit beölter und umgeformter Feinbleche, „Ratioclean“
Laufzeit vom 01.04.2009 bis 31.12.2011
Beteiligte Institute:
1) Hochschule Ulm Fakultät Produktionstechnik und Produktionswirtschaft
2) Technische Universität Kaiserslautern FB Maschinenbau u. Verfahrenstechnik AG Werkstoff- u

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.053 / IGF-Nr.: 16.317 N
Qualitätssicheres Vorbehandeln und Kleben durch den Einsatz optischer Emissionsspektroskopie - SAFEBOND
Laufzeit vom 01.03.2010 bis 30.04.2012
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.055 / IGF-Nr.: 86.260 N
Untersuchung neuer Prozessführungsstrategien zur Steigerung der Nahtfestigkeit beim Ultraschallschweißen
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen
Vorhaben: DVS-Nr.: 08.056 / IGF-Nr.: 86.110 N
Mischmaterialschweißungen beim Extrusionsschweißverfahren
Laufzeit vom 01.06.1991 bis 31.05.1993
Beteiligte Institute:
1) Friedrich-Alexander-Universität Erlangen-Nürnberg Lehrstuhl für Kunststofftechnik
Vorhaben: DVS-Nr.: 08.057 / IGF-Nr.: 14.300 D
Untersuchungen zu den Auswirkungen der Haftbeiwertsteigerung durch Verwendung von Klebstoff auf das Festigkeitsverhalten von Längspressverbindungen bei dynamisch wechselnder Beanspruchung
Laufzeit vom 01.05.1991 bis 31.12.1993
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
Vorhaben: DVS-Nr.: 08.059 / IGF-Nr.: 93.260 N
Qualitätssicherung in der Serienfertigung beim Vibrationsreibschweißen
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 08.060 / IGF-Nr.: 95.990 N
Untersuchungen zum Fügen faserverstärkter Hochleistungskunststoffe und technischer Thermoplaste
Laufzeit vom 01.10.1993 bis 30.04.1994
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
Vorhaben: DVS-Nr.: 08.061 / IGF-Nr.: 93.270 N
Entwicklung von Durchflussmeßsystemen für die maschinelle Klebstoffapplikation
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 08.065 / IGF-Nr.: 95.830 N
Einfluss der Abbindebedingungen auf das Eigenschaftsprofil geklebter Verbindungen aus Fügeteilen mit unterschiedlichen Ausdehnungskoeffizienten
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 08.066 / IGF-Nr.: 96.280 N
Nahteigenspannungen beim Extrusionsschweißen
Laufzeit vom 01.12.1993 bis 30.11.1995
Beteiligte Institute:
1) Friedrich-Alexander-Universität Erlangen-Nürnberg Lehrstuhl für Kunststofftechnik
Vorhaben: DVS-Nr.: 08.067 / IGF-Nr.: 16.384 N
Neue wirtschaftliche Messmethoden zum geregelten Klebstoffauftrag hochviskoser Klebstoffe (ThermoFlowSens)
Laufzeit vom 01.03.2010 bis 29.02.2012
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.068 / IGF-Nr.: 16.559 N
Einfluss der Dosier- und Mischtechnik auf das Eigenschaftsprofil von 2K Klebstoffen: DoMinik 2K
Laufzeit vom 01.05.2010 bis 30.04.2012
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.069 / IGF-Nr.: 16.560 N
Untersuchungen zum Einfluss einer Elektronenstrahlvorbehandlung von Titanoberflächen zur Verbesserung der Alterungsbeständigkeit von Klebungen (unter erhöhter Temperatur- und Feuchtebelastung) - OBTITAN
Laufzeit vom 01.05.2010 bis 31.10.2012
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.070 / IGF-Nr.: 00.034 E
Increase of the safety of cars for the Protection of pedestrians by Crash Resistant Adhesive Bonding on LACquered Surfaces (CRAB LACS)
Laufzeit vom 01.06.2010 bis 31.08.2012
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.071 / IGF-Nr.: 16.778 N
Eigenschaftsprofil Klebebolzen
Laufzeit vom 01.11.2010 bis 31.10.2012
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.072 / IGF-Nr.: 16.956 B
Applikation und Einsatz von faserverstärkten Klebstoffen im Bauwesen - FibrAdh -
Laufzeit vom 01.02.2011 bis 30.06.2013
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Bauhaus-Universität Weimar Institut für konstruktiven Ingenieurbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.075 / IGF-Nr.: 17.300 N
Abscheidung funktioneller Haftvermittlerschichten mittels Atmosphärendruckplasma als Primerersatz für Haftklebungen - HaftPlas -
Laufzeit vom 01.09.2012 bis 31.08.2014
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.076 / IGF-Nr.: 17.301 N
X-Bond - Entkleben unter Nutzung exothermer Reaktionen
Laufzeit vom 01.01.2013 bis 30.04.2015
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe
2) Fraunhofer-Institut für chemische Technologien (ICT)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.077 / IGF-Nr.: 17.275 N
Klebstoffe als dauerhaftes Verbundmittel bei Stahlverbundträgern
Laufzeit vom 01.10.2011 bis 31.03.2015
Beteiligte Institute:
1) Technische Universität Kaiserslautern
2) Technische Universität Kaiserslautern FB Maschinenbau u. Verfahrenstechnik AG Werkstoff- u

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.080 / IGF-Nr.: 17.618 N
Hybridfügen von Mischbaustrukturen aus faserverstärkten Kunststoffen mit metallischen Halbzeugen
Laufzeit vom 01.01.2013 bis 31.03.2015
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.082 / IGF-Nr.: 17.193 N
Einsatz der Klebtechnik zur Fertigung von Sägebändern zur ressourceneffizienten Spanung mineralischer Werkstoffe
Laufzeit vom 01.10.2012 bis 31.03.2015
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.083 / IGF-Nr.: 17.626 N
Prozesssicheres Kleben von strukturellen Aluminium-Druckguss-Komponenten
Laufzeit vom 01.12.2012 bis 30.11.2014
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.084 / IGF-Nr.: 17.777 B
Monitoring von Klebverbindungen mittels faseroptischem Messsystem
Laufzeit vom 01.05.2013 bis 31.12.2015
Beteiligte Institute:
1) Bauhaus-Universität Weimar Institut für konstruktiven Ingenieurbau
2) Materialforschungs- und Prüfanstalt an der Bauhaus Universität Weimar

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.086 / IGF-Nr.: 17.778 N
Crashsicheres 2K-Kleben von Faserverbundkunststoffen im Fahrzeugrohbau (Crash2FRP)
Laufzeit vom 01.08.2013 bis 31.12.2015
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.087 / IGF-Nr.: 18.003 N
Bedarfsgerechte qualitätsgesicherte Vorbehandlungen von FVK-Bauteilen vor der Durchführung industrieller klebtechnischer Prozesse
Laufzeit vom 01.02.2014 bis 31.01.2016
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.088 / IGF-Nr.: 18.155 N
Methoden zur Abschätzung des Verschleißes von Dosieranlagen bei der Verarbeitung von höherviskosen gefüllten Klebstoffen (Abrasio)
Laufzeit vom 01.04.2014 bis 31.12.2016
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.090 / IGF-Nr.: 18.160 N
Anforderungsgerechte Analyse und Entwicklung einer Methode zur Bewertung instationärer Zustände bei der 2K Klebstoffverarbeitung
Laufzeit vom 01.04.2014 bis 31.12.2016
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.092 / IGF-Nr.: 00.120 E
Zero Defect Manufacturing in Adhesive Bonding (ZeDeMAB)
Laufzeit vom 01.05.2014 bis 31.10.2016
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Fraunhofer-Institut für Zerstörungsfreie Prüfverfahren

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.095 / IGF-Nr.: 18.709 N
Einsatz der optisch, mechanisch und induktiv angeregten Shearografie für die zerstörungsfreie Prüfung von hochfesten Strukturklebungen und elastischen Dickschichtklebungen
Laufzeit vom 01.04.2015 bis 31.07.2017
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.097 / IGF-Nr.: 18.173 N
Nachweisführung für die Beanspruchbarkeit von hyperelastischen Klebverbindungen unter betriebsrelevanten Bedingungen
Laufzeit vom 01.05.2015 bis 31.10.2017
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.102 / IGF-Nr.: 19.207 N
Kleben von Nitinol-Mischverbindungen in der Medizintechnik
Laufzeit vom 01.01.2017 bis 31.03.2019
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe
2) NMI Naturwissenschaftliches und Medizinisches Institut an der Universität Tübingen
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.104 / IGF-Nr.: 19.206 N
Klebeignung generativ gefertigter Systeme
Laufzeit vom 01.10.2016 bis 30.09.2018
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Technische Universität Braunschweig Institut für Konstruktionstechnik (IK)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.999 / IGF-Nr.: 85.480 N
Untersuchungen zum Einfluss werkstoffkundlicher, konstruktiver und fertigungstechnischer Randbedingungen auf das Entstehen von Abbildungen beim Fügen von polymeren Werkstoffen mit Hilfe der Klebtechnik
Laufzeit vom 01.07.1991 bis 31.12.1993
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 09.026 / IGF-Nr.: 12.536 N
Ermittlung von Grundlagen für praktische Anwendung örtlicher Konzepte zur Schwingfestigkeitsbewertung geschweißter Aluminiumbauteile
Laufzeit vom 01.07.2000 bis 30.06.2003
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.000 / IGF-Nr.: 00.307 Z
Schwingfestigkeitsauslegung von geklebten Stahlbauteilen des Fahrzeugbaus unter Belastung mit variablen Amplituden
Laufzeit vom 01.01.2009 bis 31.10.2011
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Universität Kassel Institut für Mechanik Numerische Methoden der Mechanik
3) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.001 / IGF-Nr.: 15.638 N
Entwicklung einer Prozesskette zur Herstellung partiell verstärkter Blechstrukturen durch neuartige Basisklebstoffe und daran angepasste Verarbeitungstechniken
Laufzeit vom 01.06.2008 bis 31.05.2011
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Leibniz Universität Hannover Institut für Umformtechnik und Umformmaschinen

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.002 / IGF-Nr.: 00.294 Z
Falzklebeprozess im automobilen Rohbau
Laufzeit vom 01.06.2008 bis 30.11.2010
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkzeug- maschinen und Umformtechnik
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
Vorhaben: DVS-Nr.: GK.003 / IGF-Nr.: 00.338 Z
Robustheit und Zuverlässigkeit der Berechnungsmethoden von Klebverbindungen mit hochfesten Stahlblechen unter Crashbedingungen
Laufzeit vom 01.12.2009 bis 31.05.2012
Beteiligte Institute:
1) Universität Paderborn
2) Universität Kassel Institut für Mechanik Numerische Methoden der Mechanik
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
4) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.004 / IGF-Nr.: 00.319 Z
Entwicklung einer Systematik zur Anpassung von Klebstoffen und Klebverbindungen an die Anforderungen beim Kleben hochfester Stähle
Laufzeit vom 01.04.2009 bis 30.09.2011
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Technische Universität Kaiserslautern FB Maschinenbau u. Verfahrenstechnik AG Werkstoff- u

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.005 / IGF-Nr.: 17.266 B
Komplementäres Konzept zur blasenfreien Nahtabdichtung von Falzklebungen
Laufzeit vom 01.09.2011 bis 31.08.2013
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkzeug- maschinen und Umformtechnik
Vorhaben: DVS-Nr.: GK.006 / IGF-Nr.: 00.369 Z
Methodenentwicklung zur Simulation und Bewertung fertigungs- und betriebsbedingter Klebschichtschädigungen infolge Temperaturwechselbeanspruchung
Laufzeit vom 01.01.2011 bis 30.06.2013
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Universität der Bundeswehr München Institut für Mechanik
3) Universität Kassel Institut für Mechanik Numerische Methoden der Mechanik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.007 / IGF-Nr.: 00.422 Z
Experimentelle Kennwertermittlung und Simulation von strukturellen Klebverbindungen mit elastoplastischen und bruchmechanischen Kohäsivelementen
Laufzeit vom 01.04.2012 bis 30.09.2014
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Universität Kassel Institut für Mechanik Numerische Methoden der Mechanik
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.008 / IGF-Nr.: 00.444 Z
Experimentelle und numerische Untersuchungen des Crashverhaltens hybrid gefügter Verbindungen
Laufzeit vom 01.10.2012 bis 31.05.2015
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Universität Kassel Institut für Mechanik Numerische Methoden der Mechanik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: GK.009 / IGF-Nr.: 00.428 Z
Auslegung von geklebten Stahlblechkonstruktionen im Automobilbau für schwingende Last bei wechselnden Temperaturen unter Berücksichtigung des Versagensverhaltens
Laufzeit vom 01.05.2012 bis 31.10.2014
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
3) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
FA 9 - Konstruktion und Festigkeit
Vorhaben: DVS-Nr.: 09.001 / IGF-Nr.: 14.519 N
Offene und geschlossene Stahlprofile aus dem Schienenfahrzeugbau
Laufzeit vom 01.09.2005 bis 31.10.2008
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.003 / IGF-Nr.: 14.520 N
Strangpressprofil und Blechstrukturen aus Aluminiumknetlegierunen im Fahrzeugbau
Laufzeit vom 01.09.2005 bis 31.10.2008
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.007 / IGF-Nr.: 10.434 N
Mechanische Eigenschaften stanzgenieteter und geklebter Aluminiumbauteile bei dynamischer Belastung unter Medieneinwirkung
Laufzeit vom 01.12.1995 bis 30.11.1997
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 09.008 / IGF-Nr.: 10.235 N
Weiterentwicklung von Ultraschallverfahren zur Bestimmung von Schweißeigenspannungen in Aluminiumschweißverbindungen
Laufzeit vom 01.03.1995 bis 28.02.1997
Beteiligte Institute:
1) Fraunhofer-Institut für Zerstörungsfreie Prüfverfahren
Vorhaben: DVS-Nr.: 09.009 / IGF-Nr.: 10.098 B
Einfluss von Unregelmäßigkeiten (Imperfektionen) der Stumpfnaht auf das Schwingfestigkeitsverhalten schmelzgeschweißter Aluminium-Dünnblechverbindungen (t < 3mm)
Laufzeit vom 01.12.1994 bis 28.02.1997
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec
Vorhaben: DVS-Nr.: 09.010 / IGF-Nr.: 10.731 N
Festigkeitsverhalten von Aluminiumschweißverbindungen unter mehrachsigen Spannungszuständen
Laufzeit vom 01.07.1996 bis 30.06.1998
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
Vorhaben: DVS-Nr.: 09.013 / IGF-Nr.: 10.705 N
Erarbeiten von Kennwerten für Reibschweißverbindungen an Aluminium- Legierungen artgleich und mit Stahl
Laufzeit vom 01.06.1996 bis 31.05.1998
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 09.015 / IGF-Nr.: 10.978 N
Verformungsfähigkeit, Festigkeit und Zähigkeit von Schweißverbindungen an Al-Profilen: Werkstoffgesetze, Strukturmodelle, Mismatch, Crashverhalten
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
Vorhaben: DVS-Nr.: 09.016 / IGF-Nr.: 11.008 N
Konzept zur Auslegung geklebter Aluminiumteile mit Hilfe der Finite-Elemente-Methode
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 09.017 / IGF-Nr.: 11.470 N
Erarbeitung von Grundlagen zur konstruktiven Auslegung von geschweißten Anschlüssen an Vollformgussteilen
Laufzeit vom 01.01.1998 bis 31.12.1999
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
Vorhaben: DVS-Nr.: 09.018 / IGF-Nr.: 11.661 N
Lebensdauer im Bereich hoher Schwingspielzahlen (HCF)
Laufzeit vom 01.08.1998 bis 31.07.2000
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest
Vorhaben: DVS-Nr.: 09.020 / IGF-Nr.: 12.189 N
Fitness for Purpose – Bewertung von modernen Schweißverfahren für Al-Stranspreßprofile mit Schweißbadsicherung, Unters. des Festigkeitsverhaltens unter besonderer Berücksichtigung von Fertigungsimperfektionen, deren Detektion und ihrer bruchmechan. Bewer.
Laufzeit vom 01.12.1999 bis 30.11.2001
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
Vorhaben: DVS-Nr.: 09.021 / IGF-Nr.: 12.183 N
Ermittlung von Dauerschwingfestigkeitskennwerten für die Bemessung von geschweißten Aluminiumbauteilen auf der Grundlage örtlicher Strukturbeanspruchungen
Laufzeit vom 01.12.1999 bis 30.11.2001
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
Vorhaben: DVS-Nr.: 09.024 / IGF-Nr.: 12.620 N
Mittelstandsorientierte Berechnung und Dimensionierung von Klebverbindungenim Schienenfahrzeugbeu mit der Methode der Finiten Elemente und experimentelle Überprüfung der Ergebnisse
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.027 / IGF-Nr.: 12.642 N
Einfluß der Nahtvorbereitung und Nahtausführung auf die Schwingfestigkeit hochwertiger Aluminiumkonstruktionen
Laufzeit vom 01.12.2000 bis 30.11.2002
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.028 / IGF-Nr.: 12.237 N
Steigerung der Schwingfestigkeit geschweißter dünnwandiger Aluminiumbauteile durch Nachbehandlung
Laufzeit vom 01.12.1999 bis 30.11.2001
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 09.029 / IGF-Nr.: 12.755 N
Untersuchungen zum Einfluß einer Temperaturbelastung auf das Verhalten von Strukturklebungen
Laufzeit vom 01.03.2001 bis 31.08.2003
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.031 / IGF-Nr.: 12.676 N
Mittelspannungsabhängigkeit derSchwingfestigkeit geschweißter Aluminiumlegierungen
Laufzeit vom 01.11.2000 bis 31.10.2003
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.032 / IGF-Nr.: 13.716 N
Numerische Simulation von Gefügeentwicklung, Verzug und Eigenspannung zur Verbesserung des Einsatzverhaltens geschweißter Guss/Strang-Komponenten aus Aluminium
Laufzeit vom 01.05.2003 bis 30.09.2005
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.033 / IGF-Nr.: 13.140 B
Erweiterung der Anwendbarkeit des Strukturspannungskonzeptes für die Bewertung der Schwingfestigkeit von geschweißten Al-Bauteilen mit unterschiedlicher Lage von berechneter Spannung und kritischem Anrissort
Laufzeit vom 01.03.2002 bis 29.02.2004
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.035 / IGF-Nr.: 14.571 N
Untersuchung des Einflusses von Fertigungstoleranzen und Verzug auf die Festigkeitseigenschaften reibrührgeschweißter Verbindungen an hochfesten Al-Legierungen der 5000er und 7000er Serie bis 15 mm
Laufzeit vom 01.04.2006 bis 31.12.2008
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.036 / IGF-Nr.: 13.457 N
Grundlagen für die praktische Anwendung des Kerbspannungs-konzeptes zur Schwingfestigkeitsbewertung von geschweißten Bauteilen aus Magnesiumlegierungen
Laufzeit vom 01.08.2003 bis 31.07.2006
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.037 / IGF-Nr.: 13.785 B
Kennwerte von lasergeschweißten Stahlbauteilen unter Crashbelastung
Laufzeit vom 01.03.2004 bis 28.02.2006
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.038 / IGF-Nr.: 13.762 N
Auslegung von zähelastischen Metall/Faserverbundsandwich-Verbindungen
Laufzeit vom 01.03.2004 bis 31.08.2006
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.039 / IGF-Nr.: 13.717 N
Wirtschaftlicher Leichtbau durch Reibrührschweißen
Laufzeit vom 01.05.2003 bis 31.08.2005
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.041 / IGF-Nr.: 13.775 N
Experimentelle und theoretische Ermittlung der Eigenspannungen an ausgewählten Aluminiumschweißverbindungen
Laufzeit vom 01.08.2004 bis 31.07.2006
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München
2) Technische Universität München Institut für Baustoffe und Konstruktion
3) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.042 / IGF-Nr.: 14.570 N
Untersuchung des Versagensverhaltens von stanzgenieteten und punkt- und nahtgeschweißten Verbindungen aus Aluminiumwerkstoffen im Hinblick auf die Vergleichbarkeit der Schwingfestigkeitsergebnisse punktgeschweißte Dünnblechproben
Laufzeit vom 01.04.2006 bis 30.11.2008
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
2) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.043 / IGF-Nr.: 15.007 N
Betriebsfestigkeit von geschweißten Fahrradrahmen
Laufzeit vom 01.10.2006 bis 31.01.2009
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.045 / IGF-Nr.: 15.202 N
Bedeutung von Eigenspannungen für die Schwingfestigkeit geschweißter Aluminiumlegierungen
Laufzeit vom 01.04.2007 bis 30.06.2010
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.046 / IGF-Nr.: 15.377 N
Experimentelle Untersuchungen und numerische Modellierung des Verformungs- und Schädigungsverhaltens crashrelevanter Al-Schweißverbindungen
Laufzeit vom 01.10.2007 bis 31.12.2010
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.047 / IGF-Nr.: 15.378 N
Mikromagnetische Eigenspannungsbestimmung geschweißter Stähle
Laufzeit vom 01.08.2008 bis 31.12.2010
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.048 / IGF-Nr.: 16.027 N
Bewertung und Optimierung der Tragfähigkeit von Gewindebolzenschweißverbindungen unter Ermüdungsbeanspruchung
Laufzeit vom 01.04.2009 bis 31.03.2011
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV München

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.049 / IGF-Nr.: 15.913 N
Lebensdauerbewertung von Schweißverbindungen mit werkstoffmechanischen und statistischen Modellen unter besonderer Berücksichtigung von Eigenspannungen
Laufzeit vom 01.12.2008 bis 30.11.2011
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
2) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.052 / IGF-Nr.: 16.719 N
Einfluss der Schweißnahtqualität auf die Schwingfestigkeit bei Aluminiumlegierungen
Laufzeit vom 01.11.2010 bis 31.12.2013
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.053 / IGF-Nr.: 16.602 N
Einflussgrößen auf die Lage des Abknickpunktes der Wöhlerlinie für den Schwingfestigkeitsnachweis von Schweißverbindungen
Laufzeit vom 01.06.2010 bis 31.05.2013
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.054 / IGF-Nr.: 16.870 N
Qualifizierung mechanischer Randschichtverfestigungsverfahren zur Schwingfestigkeitsverbesserung geschweißter Aluminiumbauteile - Wiedervorlage
Laufzeit vom 01.08.2011 bis 31.03.2014
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.055 / IGF-Nr.: 17.559 B
Quantifizierung des Einflusses der Nahtqualität auf die Ermüdungsfestigkeit von Schweißverbindungen
Laufzeit vom 01.01.2013 bis 31.12.2015
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
2) Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.058 / IGF-Nr.: 17.520 N
Mikrostrukturbasierte Beschreibung der Entstehung von Rissen an Defekten in Schweißverbindungen
Laufzeit vom 01.05.2012 bis 31.12.2015
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.059 / IGF-Nr.: 17.457 N
Ermüdungsnachweis für Schweißverbindungen unterschiedlicher Nahtqualitäten einschließend thermozyklische, elastisch-plastische Beanspruchungen
Laufzeit vom 01.04.2012 bis 31.07.2014
Beteiligte Institute:
1) Technische Universität Darmstadt Inst. für Stahlbau und Werkstoffmechanik Fachgebiet Werks
2) Zentrum für Konstruktionswerkstoffe Staatl. Materialprüfungsanst. Darmstadt Fachgebiet u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.060 / IGF-Nr.: 17.620 B
Gestaltungshinweise für geschweißte Konstruktionen aus Aluminiumschäumen
Laufzeit vom 01.01.2013 bis 31.12.2015
Beteiligte Institute:
1) Brandenburgische Technische Universität Cottbus-Senftenburg Lehrstuhl Füge- und Schweißtec
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.062 / IGF-Nr.: 17.745 N
Tragverhalten von geschweißten Bauteilen aus Stahlguss unter Berücksichtigung von Imperfektionen und Eigenspannungen
Laufzeit vom 01.04.2013 bis 30.09.2015
Beteiligte Institute:
1) Karlsruher Institut f. Technologie KIT Stahl- und Leichtbau Versuchsanstalt f. Stahl, Holz

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.063 / IGF-Nr.: 18.344 N
Schwingfestigkeit thermisch-mechanisch gefügter Verbindungen für Mischbauanwendungen mit ultrahöchstfesten Stählen
Laufzeit vom 01.10.2014 bis 30.09.2016
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.064 / IGF-Nr.: 17.883 N
Versagensverhalten von Mischschweißverbindungen unter mehrachsiger, crashartigerund schwingender Beanspruchung am Beispiel von EMPT-Blechschweißungen
Laufzeit vom 01.01.2014 bis 30.06.2017
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
2) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.065 / IGF-Nr.: 17.700 B
Systematische Untersuchung zur Verstärkung von Stahlkonstruktionen mit kohlefaserverstärkten Kunststoffen (CFK)
Laufzeit vom 01.03.2013 bis 30.09.2015
Beteiligte Institute:
1) Brandenburgische Technische Universität Cottbus - Senftenberg Lehrstuhl Stahl- und Holzba
2) RWTH Aachen Lehrstuhl für Stahlbau und Leichtmetallbau
3) Karlsruher Institut f. Technologie KIT Stahl- und Leichtbau Versuchsanstalt f. Stahl, Holz

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.067 / IGF-Nr.: 18.986 N
Induktionsrichten geschweißter Stahlkonstruktionen (IrigS)
Laufzeit vom 01.01.2016 bis 31.12.2018
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.069 / IGF-Nr.: 18.457 N
Erhöhung der Ermüdungsfestigkeit von Offshore-Windenergieanlagen durch Schweißnahtnachbehandlung unter Berücksichtigung des Korrosionseinflusses
Laufzeit vom 01.11.2014 bis 31.10.2017
Beteiligte Institute:
1) Karlsruher Institut f. Technologie KIT Stahl- und Leichtbau Versuchsanstalt f. Stahl, Holz
2) Hochschule für angewandte Wissenschaften München Labor für Stahl- und Leichtmetallbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.070 / IGF-Nr.: 18.985 N
Qualifizierung des Reinigungsstrahlens als Nachbehandlungsverfahren zur Schwingfestigkeitsverbesserung von Schweißverbindungen
Laufzeit vom 01.01.2016 bis 31.12.2018
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.071 / IGF-Nr.: 19.102 B
Numerisch basierte Auslegung und Konstruktion für thermisch beschichtete, eigenspannungssensible Bauteilstrukturen auf polymerer Basis
Laufzeit vom 01.04.2016 bis 31.07.2018
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.072 / IGF-Nr.: 19.032 B
Einsatz von geklebten Kohlestoff-Faserverbundwerkstoffen zur Sanierung ermüdungsgeschädigter Stahlkonstruktionen (FASS)
Laufzeit vom 01.02.2016 bis 31.01.2019
Beteiligte Institute:
1) Karlsruher Institut f. Technologie KIT Stahl- und Leichtbau Versuchsanstalt f. Stahl, Holz
2) Brandenburgische Technische Universität Cottbus - Senftenberg Lehrstuhl Stahl- und Holzba
3) RWTH Aachen Lehrstuhl für Stahlbau und Leichtmetallbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.074 / IGF-Nr.: 18.789 N
Bedeutung der Qualitätsmerkmale freier Schnittkanten nach DIN EN 1090 für deren Schwingfestigkeit unter Berücksichtigung von Eigenspannungen
Laufzeit vom 01.08.2015 bis 31.01.2018
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.075 / IGF-Nr.: 18.174 B
Untersuchungen zur Schwingfestigkeit strahlgeschweißter Verbindungen unter Berücksichtigung der Schweißnahtqualität und der resultierenden Nahteigenschaften
Laufzeit vom 01.05.2015 bis 31.10.2017
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.076 / IGF-Nr.: 18.842 N
Erweiterte Schädigungskonzepte für thermomechanische Beanspruchung unter variablen Amplituden und plastischer Deformation
Laufzeit vom 01.09.2015 bis 31.08.2018
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
2) Technische Universität Darmstadt Inst. für Stahlbau und Werkstoffmechanik Fachgebiet Werks

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.126 / IGF-Nr.: 83.720 N
Einfluss von Überlasten und Kollektivänderungen auf die Lebensdauer von Schweißverbindungen
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest
Vorhaben: DVS-Nr.: 09.128 / IGF-Nr.: 80.000 D
Ermitteln und Abgrenzen des Einflusses von Fehlern auf das Festigkeitsverhalten MAG-geschweißter Verbindungen an dünnwandigen Stahlwerkstoffen
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Berlin-Brandenbu
Vorhaben: DVS-Nr.: 09.129 / IGF-Nr.: 39.600 D
Untersuchungen zur Festlegung sicherheitstechnisch begründeter Anforderungen an die Zähigkeit moderner schweißbarer Baustähle
Laufzeit vom 01.08.1991 bis 31.07.1993
Beteiligte Institute:
1) IMA Materialforschung und Anwendungstechnik GmbH
2) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
3) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 09.130 / IGF-Nr.: 36.500 D
Schweißen unter Last
Laufzeit vom 01.09.1991 bis 30.09.1993
Beteiligte Institute:
1) Brandenburgische Technische Universität Cottbus - Senftenberg Lehrstuhl Stahl- und Holzba
2) Brandenburgische Technische Universität Cottbus - Senftenberg Lehrstuhl Stahl- und Holzba
Vorhaben: DVS-Nr.: 09.131 / IGF-Nr.: 42.700 D
Schwingfestigkeiten schmelzgeschweißter Dünnblechverbindungen
Laufzeit vom 01.08.1991 bis 31.07.1993
Beteiligte Institute:
1) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 09.132 / IGF-Nr.: 43.100 D
Untersuchungen zum Auftragschweißen von unter Beanspruchung selbstverfestigenden Eisen-Mangan-Legierungen (Prof. Kecke)
Laufzeit vom 01.08.1991 bis 31.12.1993
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
Vorhaben: DVS-Nr.: 09.133 / IGF-Nr.: 93.240 N
Anwendung des Kerbgrundkonzeptes für die schwingfeste Bemessung von Schweißverbindungen aus Aluminiumknetlegierungen
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
Vorhaben: DVS-Nr.: 09.134 / IGF-Nr.: 95.140 N
Experimentelle und theoretisch/numerische Untersuchungen zur Festigkeit und Zähigkeit von Aluminium-Schweißverbindungen
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
Vorhaben: DVS-Nr.: 09.136 / IGF-Nr.: 95.920 N
Einfluss von Zugeigenspannungen auf Lebensdauer und Dauerschwingfestigkeit druckschwellbeanspruchter Schweißverbindungen
Laufzeit vom 01.12.1993 bis 30.11.1995
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
Vorhaben: DVS-Nr.: 09.3172 / IGF-Nr.: 19.178 N
Neubewertung und Erweiterung des Kerbfallkatalogs nach Eurocode 3 für eine zukunftsfähige Auslegung hochbeanspruchter Stahlkonstruktionen
Laufzeit vom 01.09.2016 bis 28.02.2019
Beteiligte Institute:
1) RWTH Aachen Lehrstuhl für Stahlbau und Leichtmetallbau
2) Karlsruher Institut f. Technologie KIT Stahl- und Leichtbau Versuchsanstalt f. Stahl, Holz
3) Universität Stuttgart Institut für Konstruktion und Entwurf
Vorhaben: DVS-Nr.: 09.900 / IGF-Nr.: 16.431 N
Erweiterung des Kerbspannungskonzeptes auf Nahtübergänge von Linienschweißnähten an dünnen Blechen
Laufzeit vom 01.12.2009 bis 31.05.2012
Beteiligte Institute:
1) Fraunhofer-Institut für Betriebsfestigkeit und Systemzuverlässig (LBF)
2) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.901 / IGF-Nr.: 16.598 N
Bauen im Bestand - Potenziale und Chance der Stahlleichtauweise
Laufzeit vom 01.05.2010 bis 31.10.2013
Beteiligte Institute:
1) Technische Universität Dortmund Fakultät Architektur u. Bauingenieurwesen
2) Technische Universität Dortmund Lehrstuhl Baukonstruktion
3) Technsiche Universität Dortmund Lehrstuhl Baubetrieb und Bauprozessmanagement
4) Karlsruher Institut f. Technologie KIT Stahl- und Leichtbau Versuchsanstalt f. Stahl, Holz
5) Technische Universität Braunschweig Institut für Werkzeugmaschinen und Fertigungstechnik
6) Technische Universität Darmstadt Fachbereich Architektur Lehrstuhl f. Tragwerksentwicklung
Vorhaben: DVS-Nr.: 09.902 / IGF-Nr.: 16.599 N
Methodenentwicklung und Leitfadenerstellung für die Bewertung der Nachhaltigkeit stählerner Kosntruktionen für erneuerbare Energien
Laufzeit vom 01.05.2010 bis 31.10.2012
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Stahlbau
2) Universität Bochum Lehrstuhl für Energieanlagentechnik Gebäude IB-/125
3) Universität Duisburg-Essen Institut für Metall- und Leichtbau
Vorhaben: DVS-Nr.: 09.903 / IGF-Nr.: 17.571 N
Betriebsfestigkeit stanzgenieteter Bauteile
Laufzeit vom 01.11.2012 bis 31.10.2015
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Technische Universität Clausthal Institut für Maschinelle Anlagentechnik und Betriebsfest

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 09.998 / IGF-Nr.: 98.230 N
Ertragbare Schnittkräfte an Aluminium-Punktschweißverbindungen unter kombinierter Belastung
Laufzeit vom 01.04.1994 bis 31.03.1996
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 09.999 / IGF-Nr.: 96.590 B
Einfluss der Kaltumformung auf die Schwingfestigkeit von Dünnblechverbindungen
Laufzeit vom 01.11.1993 bis 31.10.1995
Beteiligte Institute:
1) Otto-von-Guericke-Universität Magdeburg Institut für Werkstoff- und Fügetechnik Lehrstuhl
FA 10 - Mikroverbindungstechnik
Vorhaben: DVS-Nr.: 07.065 / IGF-Nr.: 17.405 N
Einfluss des Lotpastendrucks auf die Zuverlässigkeit der Lötstellen kritischer keramischer SMD-Komponenten auf Leiterplatten
Laufzeit vom 01.02.2012 bis 31.10.2014
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.001 / IGF-Nr.: 15.114 N
Qualifizierung eines inline Qualitätskontroll-Verfahrens zum Leitkleben von SMD-Baugruppen
Laufzeit vom 01.07.2007 bis 31.03.2009
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.002 / IGF-Nr.: 96.500 B
Untersuchungen zum Ball-Wedge-Bonden von Dickdrähten auf Nichtedelmetallbasis
Laufzeit vom 01.12.1993 bis 31.05.1996
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
Vorhaben: DVS-Nr.: 10.003 / IGF-Nr.: 10.236 B
Verbesserung der Löt- und Bondeigenschaften von Nickelschichten
Laufzeit vom 01.03.1995 bis 28.02.1997
Beteiligte Institute:
1) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
Vorhaben: DVS-Nr.: 10.005 / IGF-Nr.: 10.110 B
Drahtbonden auf flexiblen Schaltungsträgern
Laufzeit vom 01.12.1994 bis 30.11.1996
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 10.006 / IGF-Nr.: 10.290 N
Anisotrop leitfähige Klebverbindungen für nicht flexible Fügepartner mit Fine-Pitch-Kontakten
Laufzeit vom 01.07.1995 bis 30.06.1997
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
Vorhaben: DVS-Nr.: 10.009 / IGF-Nr.: 10.690 B
Erhöhung von Produktivität und Zuverlässigkeit beim Drahtbonden mit Ultraschall durch den Einsatz hochfrequenter Schwingersysteme
Laufzeit vom 01.05.1996 bis 30.04.1998
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
Vorhaben: DVS-Nr.: 10.010 / IGF-Nr.: 10.617 B
Materialtransport in stromdurchflossenen Kupfer-Lot-Kontakten
Laufzeit vom 01.03.1996 bis 28.02.1998
Beteiligte Institute:
1) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
Vorhaben: DVS-Nr.: 10.011 / IGF-Nr.: 75.000 Z
Simultane Herstellung von Microvias durch kombinierte Mikro-Umform- und Fügetechnik
Laufzeit vom 01.04.2002 bis 30.09.2004
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.013 / IGF-Nr.: 11.383 B
Thermosonic-Golddrahtbonden mit selektiver Aufheizung
Laufzeit vom 01.01.1998 bis 31.12.2000
Beteiligte Institute:
1) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
Vorhaben: DVS-Nr.: 10.015 / IGF-Nr.: 11.380 B
Mikroapplikation von Glasloten für Anwendungen in der Mikroelektronik
Laufzeit vom 01.01.1998 bis 31.12.2000
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
Vorhaben: DVS-Nr.: 10.016 / IGF-Nr.: 11.468 N
Übertragbarkeit makroskopischer thermomechanischer Klebstoff-Kennwerte auf Klebverbindungen der Oberflächenmontagetechnik
Laufzeit vom 01.01.1998 bis 31.12.2000
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik
Vorhaben: DVS-Nr.: 10.019 / IGF-Nr.: 11.875 B
Alternative Werkstoffe zum Drahtbonden im engsten Raster
Laufzeit vom 01.12.1998 bis 30.11.2000
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
Vorhaben: DVS-Nr.: 10.021 / IGF-Nr.: 12.496 N
Entwicklung eines lösbaren, formschlüssigen Mikrofügeverfahrens auf der Basis lasergestützter Modellierung von PVD-abgeschiedenen Bimetallstrukturen
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Lasertechnik
Vorhaben: DVS-Nr.: 10.022 / IGF-Nr.: 12.498 N
Reproduzierbares Dispensen elektrisch leitfähiger Klebstoffe im Sub-Nano-Liter-Bereich bei kurzen Taktzeiten
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Fraunhofer-Institut für Zerstörungsfreie Prüfverfahren

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.023 / IGF-Nr.: 12.621 N
Präzisionslötverfahren für die MEMS-Technik (microelectromechanical Systems)
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.024 / IGF-Nr.: 12.497 B
Bonden mit Cu-Draht in der Leistungselektronik
Laufzeit vom 01.06.2000 bis 31.05.2002
Beteiligte Institute:
1) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
Vorhaben: DVS-Nr.: 10.025 / IGF-Nr.: 13.138 B
Unterrsuchungen zur Unterfüllung von Bauteilen mit flächig verteilten Lötanschlüssen in der Oberflächenmontagetechnik
Laufzeit vom 01.03.2002 bis 29.02.2004
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
3) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.029 / IGF-Nr.: 13.133 N
Charakterisierung des Wärmeübergangs durch dünne Klebschichten
Laufzeit vom 01.03.2002 bis 29.02.2004
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.030 / IGF-Nr.: 13.511 N
Entwicklung von Prüfstrukturen für die Kalibrierung und den Leistungsvergleich automatischer optischer Inspektionssysteme in der Fertigung elektronischer Baugruppen
Laufzeit vom 01.08.2003 bis 31.07.2005
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.031 / IGF-Nr.: 13.361 N
Stressarme Montage von Mikrobauteilen mit Mikroklebtechniken
Laufzeit vom 01.08.2002 bis 31.12.2004
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.032 / IGF-Nr.: 13.309 B
Thermosonic Drahtbonden bei Verfarenstemperaturen unter 100°C
Laufzeit vom 01.05.2002 bis 30.04.2004
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.033 / IGF-Nr.: 13.310 B
Herstellung und Untersuchung von eutektischen SnAg- und SnAgCu-Lotbumps auf modifizierten Unterbumpmetallisierungen
Laufzeit vom 01.05.2002 bis 30.06.2004
Beteiligte Institute:
1) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.034 / IGF-Nr.: 13.636 N
Untersuchungen zum Dickdrahtbonden mit neuen Faserverbund-werkstoffen in der Leistungselektronik im Hinblick auf hohe Wechselbeständigkeit
Laufzeit vom 01.03.2004 bis 31.05.2006
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
2) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.035 / IGF-Nr.: 13.715 N
Entwicklung eigenspannungsreduzierender Maßnahmen für flächige Lötverbindungen der Mikrosystemtechnik
Laufzeit vom 01.05.2003 bis 30.04.2005
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
2) RWTH Aachen University Institut für Oberflächentechnik im Maschinenbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.036 / IGF-Nr.: 13.593 N
Zeitabhängiges Verhalten elektrisch leitfähiger Klebverbindungen unter thermomechanischer Beanspruchung
Laufzeit vom 01.03.2004 bis 31.08.2006
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.037 / IGF-Nr.: 13.554 B
Sicherung der Ausbeute und Zuverlässigkeit industriell gefertigter direkt wafergebondeter mikromechanischer Sensoren
Laufzeit vom 01.01.2003 bis 31.12.2004
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.038 / IGF-Nr.: 13.513 N
Modellbaukasten für die Simulation von Mikrofügetechnik und Mikrosystemtechnik
Laufzeit vom 01.03.2003 bis 30.04.2005
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.039 / IGF-Nr.: 13.920 B
Definition und Ermittlung der für die Mikroapplikation von Klebstoffen kritisch rheologischen Eigenschaften
Laufzeit vom 01.02.2005 bis 30.04.2007
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.040 / IGF-Nr.: 13.821 N
Zuverlässige Montagetechnik für Baugruppen mit Chip-Scale Packages
Laufzeit vom 01.02.2005 bis 30.06.2007
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.042 / IGF-Nr.: 14.819 N
Beständige, dichte Metall-Kunststoff-Verbindungen an Premolded-Gehäusen der Mikroelektronik
Laufzeit vom 01.06.2006 bis 31.08.2008
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.044 / IGF-Nr.: 14.427 N
Zuverlässigkeit bleifrei gelöteter Leistungsbaugruppe
Laufzeit vom 01.07.2005 bis 30.06.2007
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.045 / IGF-Nr.: 14.428 B
Mechanische Prüfverfahren für Mikroverbindungen elektronischer Schaltungen mit extrem verkleinerten Geometrien
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.047 / IGF-Nr.: 14.816 N
Optimierte örtliche und zeitliche Pulsformung beim Laserstrahl-Mikroschweißen von Kupfer-Aluminium-Verbindungen mit metallischen Beschichtungen
Laufzeit vom 01.07.2006 bis 30.06.2008
Beteiligte Institute:
1) Bayerisches Laserzentrum GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.048 / IGF-Nr.: 15.244 B
Thermosonic-Drahtbonden auf chemisch Silber als Endoberfläche in der COB – Technik
Laufzeit vom 01.07.2007 bis 30.06.2009
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.050 / IGF-Nr.: 15.441 B
Realisierung neuer Aufbaukonzepte für die Mechatronik durch kaltgasgespritzte Schichten
Laufzeit vom 01.07.2008 bis 30.06.2010
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
2) Technische Universität Chemnitz Institut für Werkstoffwissenschaft und Werkstofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.051 / IGF-Nr.: 15.442 N
Steigerung der Durchsatzrate und der Prozesssicherheit bei der Herstellung von Smart-Labels durch eine neuartige Aufbau- und Verbindungstechnik
Laufzeit vom 01.06.2008 bis 31.05.2010
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.052 / IGF-Nr.: 15.912 N
Wärme- und eigenspannungsarmes Fügen für die Mikrotechnik
Laufzeit vom 01.04.2009 bis 30.09.2011
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.053 / IGF-Nr.: 15.674 N
Bedeutung der Fügeteiloberflächen für die Wärmeleitung von Klebverbindungen
Laufzeit vom 01.06.2008 bis 31.05.2010
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.055 / IGF-Nr.: 16.173 N
Steigerung der Lebensdauer elektronischer Komponenten und Sensoren durch eine neuartige Kombination von Klebe- und Dichttechnik
Laufzeit vom 01.08.2009 bis 31.01.2012
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.056 / IGF-Nr.: 16.174 N
Prozessoptimierung beim Selektivlöten für Anwendungen in der Leistungselektronik
Laufzeit vom 01.08.2009 bis 31.07.2011
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.060 / IGF-Nr.: 16.279 N
Entwicklung einer Fügetechnologie für die Mikro- und Elektrotechnik unter Ausnutzung der Schmelztemperaturabsenkung bei kleinsten Partikeln
Laufzeit vom 01.12.2009 bis 31.05.2012
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht
2) Technische Universität Berlin Institut für Mechanik - Fakultät V Fachg. f. Kontinuumsmech.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.062 / IGF-Nr.: 16.672 N
Chipcrack: Modellierung der Stressempfindlichkeit von Halbleiterbauelementen aufgrund von Schädigung bei der Vereinzelung
Laufzeit vom 01.08.2010 bis 31.12.2012
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
2) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.063 / IGF-Nr.: 16.933 N
Laserstrahlfügen metallischer Funktionswerkstoffe in der Mikrotechnik
Laufzeit vom 01.08.2011 bis 31.01.2014
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.064 / IGF-Nr.: 17.370 B
Entwicklung und Herstellung von neuartigen reaktiven Multilayersystemen (RMS) für die Mikroverbindungstechnik durch PVD
Laufzeit vom 01.12.2011 bis 30.11.2014
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.065 / IGF-Nr.: 17.240 B
MAXIKON Zuverlässige Kontaktierung von Höchstleistungsbauelementen in der Leistungselektronik durch innovative Bändchen- und Litzeverbindungen
Laufzeit vom 01.07.2011 bis 30.06.2013
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
2) Fachhochschule Kiel Institut für Mechatronik
3) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.066 / IGF-Nr.: 17.456 N
Elektrostatische und fluidische Self-Assembly-Prozesse für die präzise Montage von Mikrosystemen
Laufzeit vom 01.04.2012 bis 31.12.2014
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.068 / IGF-Nr.: 17.420 N
Technologische und wirtschaftliche Prozessfenster für die gesicherte Verarbeitung der Bauform 01005 in der Elektronikproduktion
Laufzeit vom 01.09.2012 bis 28.02.2015
Beteiligte Institute:
1) Friedrich-Alexander-Universität Lehrstuhl für Fertigungsautomatisierung und Produktionssys

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.069 / IGF-Nr.: 16.990 B
Nanoskaleneffekte für metallische Niedertemperaturbondverfahren "NASE"
Laufzeit vom 01.09.2012 bis 28.02.2015
Beteiligte Institute:
1) Technische Universität Chemnitz Fak. für Elektro- u. Informationstechnik Professur für Mik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.070 / IGF-Nr.: 17.746 N
Stabilität von scannerbasierten Laserbearbeitungsverfahren im industriellen Einsatz
Laufzeit vom 01.01.2014 bis 31.08.2016
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Lasertechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.071 / IGF-Nr.: 17.624 N
Laserstrahlschweißen von Kupfer-Aluminium-Kontaktierungen mittels plattierten Übergangsstücken zur Anpassung der Verbindungsqualität an die Anforderungen mobiler Systeme und technologisch/wirtschaftlicher Verfahrensvergleich mit dem Ultraschallschweißen
Laufzeit vom 01.12.2012 bis 30.11.2014
Beteiligte Institute:
1) Bayerisches Laserzentrum GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.073 / IGF-Nr.: 00.491 Z
Prozess zum leitfähigen Kleben von Bauelementen für die Hochleistungselektronik
Laufzeit vom 01.07.2013 bis 31.12.2015
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
2) Otto-von-Guericke-Universität Magdeburg Fak. f. Elektro-. u. Informationstechn. Institut f

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.074 / IGF-Nr.: 17.790 B
ObMod - Modellierung der Bruchwahrscheinlichkeit von Halbleiterbauelementen mit Oberflächendefekten
Laufzeit vom 01.07.2013 bis 31.12.2014
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Mikrostruktur von Werkstoffen und Sys

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.076 / IGF-Nr.: 17.941 N
Erhöhung der Lötsicherheit beim Einsatz mikrolegierter Lote in der Fertigung elektronischer Baugruppen
Laufzeit vom 01.12.2013 bis 30.11.2015
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.083 / IGF-Nr.: 18.703 N
Laser-Mikroschweißen von Nitinol/Stahl- und Nitinol/Titan-Mischverbindungen in der Medizintechnik
Laufzeit vom 01.04.2015 bis 30.09.2017
Beteiligte Institute:
1) Technische Universität Berlin - Institut für Werkzeugmaschinen und Fabrikbetrieb Industrie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.084 / IGF-Nr.: 19.101 N
Herstellung von Kupfermetallisierungen auf Leistungsbauelementen mittels kaltaktiven Atmosphärenplasmas
Laufzeit vom 01.04.2016 bis 30.09.2018
Beteiligte Institute:
1) Friedrich-Alexander-Universität Lehrstuhl für Fertigungsautomatisierung und Produktionssys
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.085 / IGF-Nr.: 18.879 N
Methodenentwicklung zur quantitativen Bewertung und Vorhersage der Alterung von Klebungen unter [Hoch-] Temperatur-Belastung
Laufzeit vom 01.01.2017 bis 31.03.2019
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.087 / IGF-Nr.: 19.282 N
Mikro-Elektronenstrahlschweißen der Mischverbindungen aus Nitinol und nichtrostenden Stählen ohne Zusatzwerkstoff
Laufzeit vom 01.12.2016 bis 28.02.2019
Beteiligte Institute:
1) Universität Kassel Institut f. Produktionstechn. u.Logistik Fachg. Trennende u. Fügende Fe
2) NMI Naturwissenschaftliches und Medizinisches Institut an der Universität Tübingen

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.093 / IGF-Nr.: 19.069 B
Hermetisches Fügen von MEMS-basierten Bauelementen mithilfe von reaktiven Multischichtsystemen (RMS)
Laufzeit vom 01.03.2016 bis 30.11.2018
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS
2) Hahn-Schickard-Gesellschaft für angewandte Forschung e. V. Forschung + Entwicklung MST

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.094 / IGF-Nr.: 18.989 B
Erarbeitung einer induktiven Fügetechnologie zum Bonden von mikroelektromechanischen Systemen (MEMS)
Laufzeit vom 01.01.2016 bis 31.03.2019
Beteiligte Institute:
1) Technische Universität Chemnitz Fak. für Elektro- u. Informationstechnik Professur für Mik
2) Technische Universität Chemnitz Institut für Werkzeugmaschinen und Produktionsprozesse

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.800 / IGF-Nr.: 19.230 N
Entwicklung eines keramisch spritzgegossenen 3D-Schaltungsträgers für die Kontaktierung und Integration von Leistungselektronik mittels widerstandsarmen Aktivlots (ActivePower)
Laufzeit vom 01.10.2016 bis 31.03.2019
Beteiligte Institute:
1) Karlsruher Institut für Technologie Institut für Angewandte Materialien
2) Friedrich-Alexander-Universität Lehrstuhl für Fertigungsautomatisierung und Produktionssys
3) Karlsruher Institut für Technologie Institut für Produktionstechnik WBK

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.901 / IGF-Nr.: 00.364 Z
Wandlung von Abwärme in elektrische Energie –Entwicklung und Herstellung eines thermoelektrischen Generators aus nanokristallinem Silizium unter Berücksichtigung ökologischer Gesichtspunkte
Laufzeit vom 01.08.2010 bis 31.01.2013
Beteiligte Institute:
1) Universität Duisburg Essen Institut für Produkt Engineering - ipe Fertigungstechnik
2) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
Vorhaben: DVS-Nr.: 10.902 / IGF-Nr.: 18.476 N
Stressarme Montage von Mikrosystemen für Hochtemperaturanwendungen durch TLP-Bonden (Sensor-TLP)
Laufzeit vom 01.07.2016 bis 31.12.2018
Beteiligte Institute:
1) Albert-Ludwigs-Universität Freiburg Institut für Mikrosystemtechnik Prof. für Aufbau und
2) Hahn-Schickard-Gesellschaft für angewandte Forschung e. V. Forschung + Entwicklung MST

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 10.998 / IGF-Nr.: 11.000 N
Möglichkeiten und klebstoffspezifische Systemgrenzen von Mikroklebverbindungen mit nicht gefüllten Klebstoffen
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut f. Fertigungstechnik und angewandte Mater
Vorhaben: DVS-Nr.: 10.999 / IGF-Nr.: 10.234 N
Untersuchungen zum kombinierten Einsatz von Ultraschall und Laser beim Bonden in der Hybrid- und SMD-Technik
Laufzeit vom 01.03.1995 bis 30.11.1997
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
FA 11 - Kunststoff-Fügen
Vorhaben: DVS-Nr.: 08.024 / IGF-Nr.: 12.627 N
Bestimmung der Laserschweißeignung von Kunststoffen für unterschiedliche Wellenlängen unter Verwendung eines thermographischen Meßverfahrens
Laufzeit vom 01.10.2000 bis 30.09.2002
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen
2) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.026 / IGF-Nr.: 12.673 N
Systematische Untersuchung der Erwärmbarkeit von technischen Kunststoffen und Füllstoffen im Mikrowellen-Feld in Hinblick auf deren Eignung zum Mikrowellen-Schweißen
Laufzeit vom 01.11.2000 bis 31.10.2002
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 08.027 / IGF-Nr.: 12.672 N
Möglichkeiten und Grenzen des Fügens von Sinterkeramiken und -metallen im Grünlingsstadium
Laufzeit vom 01.11.2000 bis 31.10.2002
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik
2) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.000 / IGF-Nr.:
Qualifikation der Oberflächenmontagetechniken (richtige DVS-Nr. 11.012 - Prof. Graumüller, Wismar)
Laufzeit vom 01.07.1991 bis 30.06.1993
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
Vorhaben: DVS-Nr.: 11.002 / IGF-Nr.: 13.954 N
Heizelementschweißen von Kunststoffen - Potentiale und Grenzen im Hinblick auf Zykluszeit- und Qualitätsoptimierung
Laufzeit vom 01.02.2005 bis 31.10.2007
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.003 / IGF-Nr.: 13.512 N
Bemessungskennwerte für die Verbindungsauslegung und werkstoff- / prozessabhängige Nahteigenschaften beim Vibrationsschweißen verstärkter Thermoplaste
Laufzeit vom 01.08.2003 bis 31.07.2005
Beteiligte Institute:
1) Friedrich-Alexander-Universität Erlangen-Nürnberg Lehrstuhl für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.004 / IGF-Nr.: 13.595 N
Schweißen von Thermoplasten mit zellularer Struktur
Laufzeit vom 01.03.2003 bis 31.08.2005
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik
2) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.005 / IGF-Nr.: 13.675 N
Experimentelle Ermittlung des mechanischen Verhaltens von Kunstoffklebverbindungen mit ortsaufgelöster Verformungsmessung
Laufzeit vom 01.03.2004 bis 31.08.2006
Beteiligte Institute:
1) Universität Kassel Institut für Werkstofftechnik Fachgebiet Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.006 / IGF-Nr.: 13.553 N
Erweiterte Prozessanalyse und Erkennen von Beschädigungen der Schweißwerkzeuge durch Verwendung digitaler Generatoren
Laufzeit vom 01.03.2004 bis 28.02.2006
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.007 / IGF-Nr.: 13.955 N
On-line-Prozess-Monitoring zur Qualitätskontrolle beim Laserdurchstrahlschweißen von thermoplastischen Kunststoffen
Laufzeit vom 01.10.2004 bis 30.09.2006
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.008 / IGF-Nr.: 14.569 N
Untersuchungen zur Schweißeignung von Fluorpolymeren
Laufzeit vom 01.04.2006 bis 30.09.2008
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.013 / IGF-Nr.: 15.294 N
Induktionsschweißen von faserverstärkten Kunststoffen
Laufzeit vom 01.08.2007 bis 31.07.2009
Beteiligte Institute:
1) Institut für Verbundwerkstoffe GmbH an der TU Kaiserslautern

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.014 / IGF-Nr.: 15.111 N
Untersuchungen zur Restschmelzeschichtdicke als neues Merkmal zur Prozessoptimierung beim Ultraschallschweißen
Laufzeit vom 01.06.2007 bis 31.05.2009
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.015 / IGF-Nr.: 15.293 N
Hochgeschwindigkeits-Heizelementschweißen: Einfluss der Abzugsgeschwindigkeit und der Oberflächenbeschichtung auf das Anhaftverhalten von Polyamiden und niederviskosen Thermoplasten
Laufzeit vom 01.08.2007 bis 31.07.2009
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.016 / IGF-Nr.: 15.375 N
Untersuchungen zum Schwingfestigkeitsverhalten von Kunststoffdirektverschraubungen und Gewindeeinsätzen zum Fügen von Formteilen aus thermoplastischen Kunststoffen
Laufzeit vom 01.01.1998 bis 31.12.2000
Beteiligte Institute:
1) Technische Universität Kaiserslautern Lehrstuhl für Ressourcengerechte Produktentwicklung

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.017 / IGF-Nr.: 15.376 N
Erhöhung und Bewertung der Wirtschaftlichkeit beim Schweißen von PVC-Fensterprofilen
Laufzeit vom 01.10.2007 bis 30.09.2009
Beteiligte Institute:
1) SKZ - KFE gGmbH Kunststoff-Forschung u. Entwicklung
2) SKZ - KFE gGmbH Kunststoff-Forschung u. Entwicklung

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.018 / IGF-Nr.: 15.561 N
Selbstoptimierung und Qualitätssicherung auf Basis eines neuen Maschinenkonzeptes beim Heizelementschweißen
Laufzeit vom 01.08.2008 bis 31.01.2011
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.019 / IGF-Nr.: 15.817 N
Untersuchungen zur Schweißbarkeit von hochgefüllten holzfaserverstärkten Kunststoffen - Technologie- und Anwendungsentwicklung
Laufzeit vom 01.10.2008 bis 30.09.2010
Beteiligte Institute:
1) SKZ - KFE gGmbH Kunststoff-Forschung u. Entwicklung
2) SKZ - KFE gGmbH Kunststoff-Forschung u. Entwicklung

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.020 / IGF-Nr.: 15.971 B
Strahlungserwärmung beim Kunststoffschweißen mit Infrarotstrahlung
Laufzeit vom 01.02.2009 bis 31.01.2011
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.021 / IGF-Nr.: 16.032 N
Vibrationsschweißtechnologie zur Klebstoffhärtung beim Fügen von Kunststoffen
Laufzeit vom 01.04.2009 bis 31.03.2011
Beteiligte Institute:
1) Friedrich-Alexander-Universität Erlangen-Nürnberg Lehrstuhl für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.022 / IGF-Nr.: 16.035 N
Zykluszeitreduzierung ohne Qualitätsverlust beim Heizelement- und Vibrationsschweißen durch Zwangsabkühlung mittels Druckluft
Laufzeit vom 01.04.2009 bis 31.07.2011
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.023 / IGF-Nr.: 16.363 B
Einfluss des Bauteilverzugs beim Vibrationsschweißen auf Prozessführung und Bauteileigenschaften
Laufzeit vom 01.02.2010 bis 31.01.2012
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.026 / IGF-Nr.: 16.280 N
Laserstrahlschweißen optisch transparenter Kunststoffe ohne Absorberzusatz
Laufzeit vom 01.12.2009 bis 29.02.2012
Beteiligte Institute:
1) Bayerisches Laserzentrum GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.028 / IGF-Nr.: 16.955 N
Laserschweißen von Kunststoffen - Verfahrensvergleich und Prozessmodellierung zur Vereinfachung der fügetechnischen Qualifizierung und Auswahl sowie industriellen Umsetzung
Laufzeit vom 01.02.2011 bis 31.01.2013
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Lasertechnik
3) Rheinische Fachhochschule Köln gGmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.030 / IGF-Nr.: 17.024 B
Zeitstandfestigkeit alternativer Schweißverfahren im Apparate- und Behälterbau. Verifizierung der Prozess-Struktur-Eigenschaftsbeziehung als verfahrensunabhängige Qualitätsbeschreibung beim Schweißen.
Laufzeit vom 01.11.2011 bis 30.04.2014
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.031 / IGF-Nr.: 17.100 N
Entwicklung einer neuartigen mechanischen Befestigungslösung mit gleichmäßig krafteinleitendem Hinterschnitt
Laufzeit vom 01.04.2011 bis 30.09.2013
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.036 / IGF-Nr.: 17.924 N
Fügetechnik zur Herstellung von Mischmaterialverbindungen aus Kunststoff mit lokal an die Beanspruchung angepassten Eigenschaften
Laufzeit vom 01.01.2014 bis 31.12.2015
Beteiligte Institute:
1) Friedrich-Alexander-Universität Erlangen-Nürnberg Lehrstuhl für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.037 / IGF-Nr.: 17.997 B
Konstruktions- und Prozessoptimierung von Kunststoffnietverbindungen
Laufzeit vom 01.01.2014 bis 31.12.2015
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe
2) KUZ - Kunststoff-Zentrum in Leipzig gGmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.038 / IGF-Nr.: 16.573 B
Prozessführung beim Schweißen elektrisch leit- und ableitfähiger Kunststoffe
Laufzeit vom 01.11.2013 bis 31.10.2015
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.043 / IGF-Nr.: 18.702 N
Wirksame Faserverstärkung in der Schweißnaht beim Schweißen von faserverstärkten Kunststoffen
Laufzeit vom 01.04.2015 bis 31.12.2017
Beteiligte Institute:
1) Universität Paderborn Fakultät Maschinenbau KTP Institut für Kunststofftechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.052 / IGF-Nr.: 18.964 B
Konstruktions- und Prozessgestaltung halbschalig geschweißter Hochleistungsbauteile aus Organoblechen
Laufzeit vom 01.01.2017 bis 31.12.2018
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.055 / IGF-Nr.: 19.395 N
Absorberfreies Laserdurchstrahlschweißen von Themoplasten durch Ausnutzung intrinsischer Absorptionsbanden
Laufzeit vom 01.03.2017 bis 28.02.2019
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Lasertechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.057 / IGF-Nr.: 19.103 B
Quantifizierung der Werkstoff-Dämpfungseigenschaften zur Prozessauslegung beim Ultraschallschweißen
Laufzeit vom 01.04.2016 bis 31.03.2018
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.058 / IGF-Nr.: 19.035 B
Neue Fügemethode zur Herstellung von Thermoplast- und Thermoplast-Metall-Hybridverbindungen mittels reaktiven Multischichtsystemen (RMS)
Laufzeit vom 01.02.2016 bis 31.07.2018
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkstoff- und Strahltechnik IWS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.060 / IGF-Nr.: 19.212 B
Tragfähigkeitserhöhung von geklebten FKV- und Multi-Material-Verbindungen durch optimierte Gestaltung und Fertigung der FKV-Fügeteilwerkstoffe
Laufzeit vom 01.12.2016 bis 28.02.2019
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Einrichtung für Großstrukturen in der Produktionst

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.900 / IGF-Nr.: 82.470 N
Lötbarkeitsmessung an SMD’S (richtige DVS-Nr. 11.005)
Laufzeit vom 01.06.1992 bis 31.01.1994
Beteiligte Institute:
1) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau
Vorhaben: DVS-Nr.: 11.901 / IGF-Nr.: 00.141 E
Graphene applications in polymers and polymer-based composites
Laufzeit vom 01.05.2015 bis 30.04.2017
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkzeug- maschinen und Umformtechnik
3) Technische Universität Chemnitz Institut für Fördertechnik und Kunststoffe

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 11.993 / IGF-Nr.: 10.022 B
Durchgängiger PVD-Prozess zur Herstellung von Lotbumps
Laufzeit vom 01.09.1994 bis 31.08.1996
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
Vorhaben: DVS-Nr.: 11.994 / IGF-Nr.: 86.250 N
Untersuchungen an schutzlackierten Leiterplatten unter Feuchteeinwirkung
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Technische Universität München Lehrstuhl für Werkstoffe im Maschinenbau
Vorhaben: DVS-Nr.: 11.995 / IGF-Nr.: 86.140 N
Untersuchungen zur prozessintegrierten Qualitätskontrolle beim Ultraschallbonden
Laufzeit vom 01.12.1996 bis 30.11.1998
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 11.996 / IGF-Nr.: 14.200 D
Optimierung von Bumpsystemen hoher Packungsdichte
Laufzeit vom 01.05.1991 bis 30.04.1993
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
Vorhaben: DVS-Nr.: 11.997 / IGF-Nr.: 92.360 B
„Zerstörungsfreie Qualitätsprüfung von Löt—und Mikroschweißverbindungen“
Laufzeit vom 01.07.1993 bis 30.06.1995
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
Vorhaben: DVS-Nr.: 11.998 / IGF-Nr.: 10.394 B
Ultraschall-Keilbonden im engsten Raster mit feinsten Bonddrähten und modifizierten modifizierten Bondwerkzeugen
Laufzeit vom 01.10.1995 bis 30.09.1997
Beteiligte Institute:
1) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Zuverlässigkeit und Mikrointegration
3) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
4) Technische Universität Dresden Institut für Aufbau- und Verbindungs- technik der Elektroni
Vorhaben: DVS-Nr.: 11.999 / IGF-Nr.: 96.270 N
Elektrisch leitfähiges Kontaktieren von Fine-Pitsch-Bauelementen mit nichtgefüllten Klebstoffen
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Siliziumtechnologie
FA 13 - Generative Fertigungsverfahren - Rapidtechnologie
Vorhaben: DVS-Nr.: / IGF-Nr.: 00.086 E
Zero Defect Additive Manufacturing (ZeDAM)
Laufzeit vom 01.01.2013 bis 31.05.2015
Beteiligte Institute:
1) Werkzeugmaschinenlabor WZL der RWTH Aachen
2) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkzeug- maschinen und Umformtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.002 / IGF-Nr.: 00.415 Z
Analyse der Einflussfaktoren auf das mechanisch-technologische Eigenschaftsprofil von lasergenerierten Titanbauteilen - AlaTin -
Laufzeit vom 01.03.2012 bis 31.08.2014
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH
2) Technische Universität Hamburg-Harburg Institut für Laser- und Anlagen- systemtechnik (iLA

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.003 / IGF-Nr.: 17.184 B
Eigenspannungen und Verzüge im Strahlschmelzprozess - Untersuchungen der verschiedenen Einflüsse und Maßnahmen zur Reduzierung
Laufzeit vom 01.09.2012 bis 31.12.2014
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkzeug- maschinen und Umformtechnik
2) Universität Duisburg Essen Institut für Produkt Engineering - ipe Fertigungstechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.005 / IGF-Nr.: 16.669 B
Steigerung der Leistungsfähigkeit des selektiven Laserstrahlschmelzens (SLM) durch den Einsatz von angepassten Prozessgasen
Laufzeit vom 01.09.2012 bis 31.08.2014
Beteiligte Institute:
1) Günter-Köhler-Institut für Fügetechnik und Werkstoffprüfung GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.007 / IGF-Nr.: 17.911 N
Qualitätssicherung eim Laserstrahlschmelzen von metallischen Bauteilen durch thermografische Schichtüberwachung
Laufzeit vom 01.01.2014 bis 30.06.2016
Beteiligte Institute:
1) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.010 / IGF-Nr.: 18.091 N
Simulationsbasierte Untersuchung von Bauteilverzug beim Laser-Sintern von Kunststoffen zur Entwicklung von prozesstechnischen Reduzierungsmaßnahmen (Sim-BaV-LS)
Laufzeit vom 01.03.2014 bis 31.05.2016
Beteiligte Institute:
1) Universität Duisburg Essen Institut für Produkt Engineering - ipe Fertigungstechnik
2) Universität Bremen Bremer Center for Computational Materials Science BCCMS

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.011 / IGF-Nr.: 18.639 N
Verbesserung der Oberflächenqualität von SLM Bauteilen durch Entwicklung einer SLM Prozessführung mit diskontinuierlicher Energieeinbringung
Laufzeit vom 01.04.2015 bis 30.09.2017
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Lasertechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.014 / IGF-Nr.: 19.394 N
Qualitätssteigerung laseradditiv gefertigter Bauteile durch Optimierung des lokalen Wärmeeintrags unter Berücksichtigung des globalen Temperaturfeldes
Laufzeit vom 01.03.2017 bis 28.02.2019
Beteiligte Institute:
1) Universität Bremen Bremer Center for Computational Materials Science BCCMS
2) Technische Universität Hamburg-Harburg Institut für Laser- und Anlagen- systemtechnik (iLA
3) Fraunhofer-Gesellschaft e.V. Fraunhofer-Einrichtung für Additive Produktionstechnologien I

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.015 / IGF-Nr.: 18.859 B
Untersuchungen zur thermischen Nachbehandlung generativ gefertigter Bauteile
Laufzeit vom 01.10.2015 bis 30.09.2017
Beteiligte Institute:
1) Universität Rostock Fakultät Maschinenbau und Schiffstechnik Lehrstuhl für Werkstofftechni
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Werkzeug- maschinen und Umformtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: 13.800 / IGF-Nr.: 18.712 N
Simulative Optimierung und generative Fertigung von statischen Mischern für die Extrusion von Kunststoffen
Laufzeit vom 01.09.2016 bis 28.02.2019
Beteiligte Institute:
1) Institut für Kunststoffverarbeitung (IKV) Industrie und Handwerk an der RWTH Aachen
2) Fraunhofer-Gesellschaft e.V. Fraunhofer-Institut für Lasertechnik

[weitere Informationen zum Projekt]
FA I2 - Anwendungsnahe Schweißsimulation
Vorhaben: DVS-Nr.: 12.001 / IGF-Nr.: 81.920 N
Aufbau eines wissensbasierten Systems zur Unterstützung der Konstruktion und Fertigung beim Einsatz der Klebtechnik - Expertensystem Welle-Nabe
Laufzeit vom 01.09.1990 bis 31.08.1992
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: 12.004 / IGF-Nr.: 83.700 N
Aufbau eines Expertensystems zum Schweißen von Gußeisen mit Kugelgraphit
Laufzeit vom 01.12.1990 bis 30.11.1992
Beteiligte Institute:
1) Technische Universität Clausthal Institut für Schweißtechnik und Trennende Fertigungsverfa
Vorhaben: DVS-Nr.: 12.005 / IGF-Nr.: 86.270 N
Entwicklung eines Steuerungs- und Diagnosesystems für die automatisierte Online-Schweißprozessoptimierung durch die informationstechnische Kopplung mit einem existierenden Expertensystems
Laufzeit vom 01.06.1991 bis 31.05.1993
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 12.007 / IGF-Nr.: 86.220 N
Aufbau eines Beratungs- und Informationssystems für das Widerstandspunktschweißen
Laufzeit vom 01.08.1991 bis 31.07.1993
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
2) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 12.008 / IGF-Nr.: 14.100 D
Rechnergestützte Erarbeitung von Zusammenbau- und Schweißfolgeplänen als Grundlage für die Gestaltung und Vorbereitung technologischer Schweißfertigungsabläufe
Laufzeit vom 01.05.1991 bis 31.08.1993
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.
2) Technische Universität Dortmund Lehrstuhl für Werkstofftechnologie Fakultät Maschinenbau
Vorhaben: DVS-Nr.: 12.009 / IGF-Nr.: 93.150 N
Entwicklung eines Expertensystems zur Prozessoptimierung beim Lichtbogenschweißen unter Nutzung von Prozessdaten aus dem Schweißprozess
Laufzeit vom 01.01.1993 bis 31.12.1994
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik
Vorhaben: DVS-Nr.: 12.011 / IGF-Nr.: 96.210 N
Integrierte rechnerunterstützte Konstruktionsumgebung für geschweißte Bauteile unter Verwendung neuartiger Programmierschnittstellen
Laufzeit vom 01.10.1993 bis 30.09.1995
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Konstruktionstechnik (IK)
Vorhaben: DVS-Nr.: 12.012 / IGF-Nr.: 96.200 N
Aufbau eines wissensbasierten Systems für das Fügen von Rohrverbindungen mittels Kleben
Laufzeit vom 01.11.1993 bis 31.10.1995
Beteiligte Institute:
1) Universität Paderborn Fakultät für Maschinenbau, Laboratorium für Werkstoff- und Fügetechn
Vorhaben: DVS-Nr.: I2.000 / IGF-Nr.: 15.274 N
Effiziente numerische Schweißsimulation großer Strukturen
Laufzeit vom 01.07.2007 bis 30.04.2010
Beteiligte Institute:
1) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.001 / IGF-Nr.: 15.275 N
Simulationsgestützte bauteilbezogene Analyse industriell relevanter Einspannsituationen beim Schweißen
Laufzeit vom 01.07.2007 bis 30.04.2010
Beteiligte Institute:
1) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.002 / IGF-Nr.: 15.709 B
Verzugs- und Eigenspannungssimulation von Al-Stahl-Mischverbindungen
Laufzeit vom 01.07.2008 bis 31.12.2010
Beteiligte Institute:
1) Brandenburgische Technische Universität Cottbus-Senftenburg Lehrstuhl Füge- und Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.003 / IGF-Nr.: 16.216 N
Schnelle und automatisierte Temperaturfeldgenerierung für die Schweißverzugssimulation
Laufzeit vom 01.09.2009 bis 31.08.2011
Beteiligte Institute:
1) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.004 / IGF-Nr.: 16.441 B
Rechnergestützte Vorhersage der Kaltrisssicherheit laserstrahlgeschweißter Bauteile aus hochfesten Stählen
Laufzeit vom 01.12.2009 bis 30.06.2012
Beteiligte Institute:
1) Brandenburgische Technische Universität Cottbus-Senftenburg Lehrstuhl Füge- und Schweißtec
2) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.005 / IGF-Nr.: 16.718 N
Schnelle numerische Methoden für die effiziente Temperaturfeldberechnung in bauteilnahen Geometrien und Mehrlagenschweißungen
Laufzeit vom 01.09.2010 bis 31.12.2012
Beteiligte Institute:
1) RWTH Aachen Lehr- u. Forschungsgebiet für nichtlinea Dynamik der Laser- und Fertigungsverf
2) Bundesanstalt für Materialforschung und -prüfung (BAM) FB 9.3 - Schweißtechn. Fertigungsv

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.006 / IGF-Nr.: 00.360 Z
Kopplung von Prozess-, Gefüge- und Struktursimulation zur Beurteilung der quasi-statischen Festigkeit laserstrahlgeschweißter Hybrid-Verbindungen (HyProMiS)
Laufzeit vom 01.06.2010 bis 31.05.2012
Beteiligte Institute:
1) BIAS - Bremer Institut für angewandte Strahltechnik GmbH
2) IWT Stiftung Institut für Werkstofftechnik
3) Universität Bremen

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.009 / IGF-Nr.: 16.857 N
Prozessbegleitendes dynamisches Spannen zur Verzugs- und Eigenspannungsoptimierung beim Schweißen von Bauteilen
Laufzeit vom 01.06.2012 bis 28.02.2015
Beteiligte Institute:
1) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (
2) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.010 / IGF-Nr.: 17.619 N
Berechnung von Eigenspannungen in Mehrlagenrohrschweißverbindungen und Quantifizierung des Einflusses auf die Lebensdauer bei Schwingbeanspruchung
Laufzeit vom 01.12.2012 bis 31.12.2015
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik
2) Fraunhofer-Institut für Werkstoffmechanik IWM

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.012 / IGF-Nr.: 00.476 Z
Optimierungsstrategien zum Schweißen hochlegierter Bleche
Laufzeit vom 01.04.2013 bis 30.09.2015
Beteiligte Institute:
1) Technische Universität Ilmenau Fakultät für Maschinenbau Fachgebiet Fertigungstechnik
2) Bauhaus-Universität Weimar Institut für konstruktiven Ingenieurbau

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.900 / IGF-Nr.: 00.287 Z
Einsatz der Schweißsimulation zur systematischen Entwicklung verbesserter Modelle für die Berechnung der Tragfähigkeit komplexer Stahlleichtbaustrukturen
Laufzeit vom 01.04.2008 bis 31.12.2010
Beteiligte Institute:
1) Technische Universität Braunschweig Institut für Füge- und Schweißtechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: I2.901 / IGF-Nr.: 17.294 N
Simulationsgestützte Erfassung von Humping und Einbrandkerben unter Berücksichtigung der temperaturabhängigen Dichte im Schmelzbad
Laufzeit vom 01.10.2011 bis 31.03.2014
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
FA Q6 - Arbeitssicherheit und Umweltschutz
Vorhaben: DVS-Nr.: Q6.000 / IGF-Nr.: 14.994 N
Nanoskalige Partikel an Schweißarbeitsplätzen
Laufzeit vom 01.04.2007 bis 31.05.2009
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.001 / IGF-Nr.: 14.436 B
Optimierung der Schweißraucherfassung an brennerintegrierten Absauganlagen
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.002 / IGF-Nr.: 14.437 N
Pilotstudie zum Einsatz neuartiger nichtinvarsiver Untersuchungs-methoden zur Frühdiagnostik adverser Atemwegseffekte bei Schweißern
Laufzeit vom 01.06.2005 bis 31.05.2006
Beteiligte Institute:
1) Universitätsklinikum Aachen AöR Institut für Arbeits-, Sozial- und Umweltmedizin

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.003 / IGF-Nr.: 14.431 N
Bereitstellung eines praxisbezogenen "analyserichtigen" Probenahmeverfahrens zur Messung der Schweißrauchkonzentration im Atembereich der Schweißer
Laufzeit vom 01.06.2005 bis 31.05.2007
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.004 / IGF-Nr.: 14.438 N
Untersuchungen zu Schweißrauchemissionen aus neuen Hochleistungs-Schweiß- und MSG-Lötprozessen
Laufzeit vom 01.06.2005 bis 30.11.2007
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.005 / IGF-Nr.: 00.213 Z
Schweißerschutzkleidung mit verbessertem Tragekomfort und erhöhter Schutzwirkung
Laufzeit vom 01.04.2006 bis 31.03.2008
Beteiligte Institute:
1) GSI - Gesellschaft für Schweißtechnik International mbH Niederlassung SLV Duisburg
2) Hohenstein Institut für Textil- innovationen e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.007 / IGF-Nr.: 15.594 N
Entwicklung von technischen Konzepten zur Anlagensicherheit in Zusammenhang mit neuen, hochenergetischen Laserstrahlquellen
Laufzeit vom 01.07.2008 bis 30.06.2010
Beteiligte Institute:
1) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.008 / IGF-Nr.: 15.775 N
Messtechnische Bestimmung von Emissionsdaten zur Durchführung einer Emissionsbewertung und Ermittlung umweltbezogener Kosten beim Laserstrahlfügen metallischer Werkstoffe
Laufzeit vom 01.09.2008 bis 28.02.2010
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.012 / IGF-Nr.: 16.515 N
Analyse und Verbesserung eines integrierten Absaugbrenners zur Erhöhung der Wirtschaftlichkeit des Prozesses und zur Verbesserung der Arbeitsbedingungen
Laufzeit vom 01.04.2010 bis 30.09.2011
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.014 / IGF-Nr.: 00.433 Z
Experimentelle Untersuchung des Einflusses der Prozessbedingung bei der Laserbearbeitung von Kunststoffen auf die Freisetzung von partikel- und gasförmigen Emissionen sowie Bewertung des Gefährdungspotenzials
Laufzeit vom 01.08.2012 bis 31.10.2014
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) SKZ - KFE gGmbH Kunststoff-Forschung u. Entwicklung
3) SKZ - KFE gGmbH Kunststoff-Forschung u. Entwicklung

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.016 / IGF-Nr.: 17.349 N
Passive Lasersicherheit für Hochleistungslaser im industriellen Einsatz (PaLaSi)
Laufzeit vom 01.09.2012 bis 31.05.2015
Beteiligte Institute:
1) Technische Universität München Institut für Werkzeugmaschinen und Betriebswissenschaften (

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.017 / IGF-Nr.: 17.557 B
Minimierung der Emissionsraten beim MSG-Schweißen mit Fülldrahtelektroden
Laufzeit vom 01.01.2013 bis 31.12.2014
Beteiligte Institute:
1) Technische Universität Chemnitz Institut für Füge- und Montagetechnik Professur Schweißtec

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.018 / IGF-Nr.: 17.990 N
Strömungstechnische Auslegungskriterien zur Erhöhung der Absaugungseffektivität von integrierten Absaugbrennern in Zwangslagen
Laufzeit vom 01.12.2013 bis 31.05.2016
Beteiligte Institute:
1) Technische Universität Berlin Institut für Werkzeugmaschinen und Fabrikbetrieb - Beschicht

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.019 / IGF-Nr.: 18.179 B
Reduzierung gefährlicher Schweißrauche durch die Trennung von Lichtbogen und Zusatzwerkstoff - Emissionsreduziertes Schweißen mit MSG-Zusatzdraht und WIG-Heißdraht
Laufzeit vom 01.05.2014 bis 30.04.2016
Beteiligte Institute:
1) Technische Universität Dresden Institut für Fertigungstechnik Professur für Fügetechnik u.

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: Q6.020 / IGF-Nr.: 18.333 N
Emissionsminimierung für industriell relevante Metall-Schutzgas-Schweißprozesse unter Einhaltung einer geforderten Nahtqualität
Laufzeit vom 01.09.2014 bis 28.02.2017
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
FA V4 - Unterwassertechnik
Vorhaben: DVS-Nr.: V4.002 / IGF-Nr.: 16.777 N
Systematische Untersuchung von Lichtbogenprozessen für das nasse Elektrodenschweißen unter Wasser in Tiefen größer 20 Meter
Laufzeit vom 01.11.2010 bis 30.04.2013
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.004 / IGF-Nr.: 17.149 N
Hydrophobierung von Stabelektroden für das Lichtbogenhandschweißen unter Wasser
Laufzeit vom 01.05.2011 bis 30.04.2013
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde
2) FGK Forschungsinstitut für Anorganische Werkstoffe Glas/Keramik GmbH

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.005 / IGF-Nr.: 17.333 N
Entwicklung und Qualifizierung automatisierter zerstörungsfreier Prüftechniken zur Bauwerk- und Schweißnahtprüfung unter Wasser
Laufzeit vom 01.11.2011 bis 31.03.2014
Beteiligte Institute:
1) Jade Hochschule Oldenburg

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.007 / IGF-Nr.: 17.888 N
Elektrokontakttrennen mittels CAMG-Technik zum manuellen und halbautomatischen Trennen von Spundwänden unter Wasser
Laufzeit vom 01.10.2013 bis 30.09.2015
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.009 / IGF-Nr.: 18.281 N
Laserstrahlschneiden unter Wasser für höhere Produktivität
Laufzeit vom 01.07.2014 bis 30.09.2016
Beteiligte Institute:
1) Laser Zentrum Hannover e.V.
2) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.010 / IGF-Nr.: 18.158 N
Mechanisch technologische Eigenschaften unterwassergeschweißter hoch- und höherfester Stähle
Laufzeit vom 01.04.2014 bis 30.06.2017
Beteiligte Institute:
1) RWTH Aachen University Institut für Schweißtechnik und Fügetechnik

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.013 / IGF-Nr.: 18.708 N
Autogenes MAG-C Schweißen als Hybridprozess für das kontinuierliche, nasse, hyperbare Unterwasserschweißen (UW-A-MAG-C) mit Massivdrahtelektroden
Laufzeit vom 01.04.2015 bis 30.09.2017
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.014 / IGF-Nr.: 19.029 B
Werkstofftechnisch basiertes Abschreckmodell für die Simulation des Unterwasserschweißens
Laufzeit vom 01.02.2016 bis 31.05.2018
Beteiligte Institute:
1) Universität Rostock Fakultät Maschinenbau und Schiffstechnik Lehrstuhl für Werkstofftechni
2) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.016 / IGF-Nr.: 19.211 N
Verminderung der wasserstoffinduzierten Kaltrissigkeit beim nassen Unterwasserschweißen von höherfesten Feinkornstählen durch die Integration von austenitischem Schweißgut in die Schweißfolge
Laufzeit vom 01.12.2016 bis 30.11.2018
Beteiligte Institute:
1) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
Vorhaben: DVS-Nr.: V4.018 / IGF-Nr.: 19.210 B
Optimierung des Tragverhaltens unter Wasser gefügter Bolzenschweißverbindungen großer Dimensionen für Reparatur- und Instandhaltungsmaßnahmen
Laufzeit vom 01.10.2016 bis 30.09.2018
Beteiligte Institute:
1) Fraunhofer-Gesellschaft e.V. Fraunhofer-Einrichtung für Großstrukturen in der Produktionst
2) Leibniz Universität Hannover Institut für Werkstoffkunde

[weitere Informationen zum Projekt]
ohne FA-Bezug
Vorhaben: DVS-Nr.: 00.001 / IGF-Nr.: 16.433 N
Komplexitätsindex als Entscheidungsgrundlage für die Produktporgrammgestaltung bei KMU
Laufzeit vom 01.12.2009 bis 31.03.2011
Beteiligte Institute:
1) Technische Universität München Lehrstuhl für Betriebswirtschaftslehre Unternehmensführung/
2) Friedrich-Alexander-Universität Erlangen-Nürnberg

[weitere Informationen zum Projekt]